Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor protein kinase walK (walK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor Protein Kinase WalK (WalK)

The WalK protein is a sensor histidine kinase (HK) that is part of a two-component system (TCS) with its cognate response regulator (RR) WalR . TCSs are essential for bacteria to sense environmental changes and adapt by regulating gene expression . In Staphylococcus aureus, the WalKR system is the only essential TCS, controlling autolysins involved in peptidoglycan remodeling and cell division .

WalK Structure and Function

WalK, like other HKs, has a conserved dimerization and histidine phosphorylation (DHp) domain and a catalytic ATP-binding (CA) domain . These domains are part of a universal catalytic module with an HATPase_c fold . The DHp domain is responsible for autophosphorylation of WalK at a histidine residue, while the CA domain binds ATP . WalK interacts directly with the response regulator WalR, facilitating phosphoryl transfer . This interaction is crucial for the signaling process of the TCS .

WalKR Interactions and Regulation

WalK and WalR interact through their respective domains, with the WalK C-terminal tail (CTT) playing a crucial role in the interaction with the WalR DNA-binding domain (DBD) . The WalKR system regulates various genes involved in cell wall metabolism, protein biosynthesis, nucleotide metabolism, and DNA replication . Specifically, WalKR influences the expression of autolysin genes and essential genes involved in lipoteichoic acid synthesis, translation, DNA compaction, and purine nucleotide metabolism .

Functional Studies and Mutant Analysis

Studies using split luciferase fusions have demonstrated the interaction between WalK and WalR throughout different growth phases in S. aureus . Mutants with altered WalKR activities have been used to define the WalR DNA-binding motif and direct regulon through functional genomics, including chromatin immunoprecipitation sequencing . "Up" mutants, such as WalK Y32C and WalK T389A, show enhanced interaction and increased susceptibility to oxacillin and tunicamycin, while "down" mutants, such as WalR D53A and WalK G223D, exhibit reduced interaction .

Importance of WalKR System

The WalKR system is essential in S. aureus, serving as a master regulator of cell growth by coordinating the expression of genes from multiple fundamental cellular processes . It links cell wall homeostasis with purine biosynthesis, protein biosynthesis, and DNA replication . The essentiality of WalKR and its role in virulence make it a target for novel anti-staphylococcal therapeutics .

Research Findings

FindingDescriptionReference
WalK-WalR InteractionImmediate interaction observed, peaking in mid-exponential phase and declining in stationary phase.
"Up" MutantsEnhanced WalK/WalR interaction, increased susceptibility to oxacillin and tunicamycin.
"Down" MutantsReduced WalK/WalR interaction during lag phase.
WalK C-Terminal Tail (CTT)Crucial for interaction with WalR DNA-binding domain (DBD).
WalKR RegulonIncludes genes involved in cell wall metabolism, protein biosynthesis, nucleotide metabolism, and DNA replication.
Impact on Antibiotic SusceptibilityMutational activation of WalKR causes a striking increase in susceptibility to oxacillin and tunicamycin.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
walK; SSP0022; Sensor protein kinase WalK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
walK
Target Protein Sequence
MKWLKHFQSLHTKLVIVYVLLIIIGMQIIGLYFTNSLEKELTQTFKNNISQYAKQIEINI EKVYDEDNAINAQKEVQNLLNEYANRQEIEEIRFIDKDQIIMATSKQSTRSLINQKANDN SIQKALSLGEINSHTVLKDYGNGKQRVWVYNLPVKTSNDGTIGDVYIEADINDVYNQLSN INQIFIVGTGISLLITVILGFFIARTITKPITDMRNQTVEMSKGNYTQRVKIYGNDEIGE LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRVRIVNDMALTMMGTM KEDIIGDHMLKVLKLEEDFSLDEIQENNDSFLLDINENEGIIARVNFSTIVQETGFVTGY IAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALESGAWKDGELAPQFLSVT REETERMIRLVNDLLQLSKMDNESEQITKEIVDFNMFINKIINRHEMSAKDTTFVREVPT ETIFTEIDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNALYNRMTIRVKDNGIGIPIN KVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCE VLEDGDWDAE
Uniprot No.

Target Background

Function

WalK is a sensor protein kinase belonging to the two-component regulatory system WalK/WalR in Staphylococcus saprophyticus subsp. saprophyticus. It functions as a sensor kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to WalR.

Database Links

KEGG: ssp:SSP0022

STRING: 342451.SSP0022

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the WalK sensor kinase in Staphylococcus saprophyticus and what is its significance?

WalK is a membrane-anchored sensor histidine kinase that forms one half of the essential WalRK two-component system (TCS) in Staphylococcus saprophyticus. This system is among the most broadly conserved TCS in Firmicutes bacteria . In S. saprophyticus, as in other staphylococci, WalK likely plays a critical role in cell wall metabolism and homeostasis. Given that S. saprophyticus is a significant cause of urinary tract infections, particularly in young sexually active females , understanding the WalK regulatory system may provide insights into its pathogenicity and potential therapeutic targets.

Methodological approach: To study WalK in S. saprophyticus, researchers should first identify the walK gene through genomic analysis and sequence comparison with well-characterized walK genes from related species such as S. aureus. Homology modeling based on S. aureus WalK can help predict structural features specific to S. saprophyticus WalK.

What are the key structural domains of WalK protein and their functions?

The WalK protein contains several functional domains that are likely conserved in S. saprophyticus:

  • Transmembrane domain - anchors the protein in the bacterial cell membrane

  • Extracellular sCache domain (PAS-like domain) - a 148 amino acid sensing loop that detects cell wall peptidoglycan fragments

  • HAMP domain - transmits signals from the sensor to the cytoplasmic region

  • Histidine kinase domain - contains the conserved histidine residue that gets phosphorylated

  • C-terminal tail (CTT) - contains the W-Acidic motif critical for interaction with WalR

Methodological approach: Domain function analysis requires generating truncated or point-mutated versions of WalK and assessing their impact on kinase activity, WalR interaction, and signaling efficiency through phosphotransfer assays.

What are effective strategies for expressing and purifying recombinant WalK from S. saprophyticus?

Based on approaches used with S. aureus WalK, researchers can consider the following protocol for S. saprophyticus WalK:

  • Gene synthesis or PCR amplification of the walK gene from S. saprophyticus genomic DNA

  • Cloning into an expression vector with appropriate tags (e.g., N-terminal 10xHis-tag and C-terminal Myc-tag as used for S. aureus WalK)

  • Expression in E. coli system (BL21 DE3 or similar strain)

  • Purification using immobilized metal affinity chromatography followed by size exclusion chromatography

For membrane proteins like WalK, consider expressing only the cytoplasmic portion for easier handling, or use specialized detergents for full-length protein extraction.

Expression System ComponentsAdvantagesChallenges
pET system in E. coliHigh yield, inducible expressionPotential inclusion body formation
Cell-free expressionAvoids toxicity issuesLower yield, higher cost
Truncated constructs (cytoplasmic domain only)Easier purification, higher solubilityLoss of transmembrane functionality
Full-length with solubilization agentsComplete protein functionComplex purification process

How can I verify the biological activity of purified recombinant S. saprophyticus WalK?

To confirm functional activity of recombinant WalK:

  • Autophosphorylation assay - Incubate purified WalK with ATP (ideally γ-32P-ATP) and detect phosphorylation by autoradiography or phospho-specific antibodies

  • Phosphotransfer assay - Test the ability of phosphorylated WalK to transfer the phosphate group to purified WalR

  • WalK-WalR interaction assay - Use split luciferase complementation assays similar to those employed with S. aureus WalK

  • Ligand binding assay - Assess binding of potential peptidoglycan fragments to the sCache domain using techniques like isothermal titration calorimetry

How does WalK sense cell wall integrity in S. saprophyticus?

Based on studies in B. subtilis, WalK likely monitors cell wall hydrolysis by sensing specific peptidoglycan fragments . In particular:

  • The extracellular sCache domain of WalK appears to detect D,L-endopeptidase cleavage products from the cell wall peptidoglycan

  • WalK specifically responds to cleavage products generated by D,L-endopeptidases rather than other peptidoglycan hydrolases

  • This sensing mechanism allows WalK to monitor the activity of essential cell wall hydrolases and regulate their expression through WalR

Methodological approach: To study this in S. saprophyticus, researchers can generate walK mutants with deleted or modified sCache domains and assess their response to exogenously added peptidoglycan fragments or overexpression of specific cell wall hydrolases.

What is the relationship between WalK activation and bacterial growth phases?

The WalK-WalR interaction shows a distinctive pattern throughout bacterial growth:

  • Interaction begins immediately upon dilution in fresh media

  • Peak interaction occurs during mid-exponential growth phase

  • Rapid decline to undetectable levels in stationary phase

This pattern suggests that WalK activity is tightly linked to active cell wall synthesis and remodeling during growth. In S. saprophyticus, which colonizes the perineum, rectum, urethra, cervix, and gastrointestinal tract , this regulation may be especially important during the transition from commensal to pathogenic states.

How can I investigate the role of the W-Acidic motif in S. saprophyticus WalK function?

The W-Acidic motif in WalK's C-terminal tail is crucial for interaction with WalR and subsequent signaling . To study this in S. saprophyticus:

  • Identify the W-Acidic motif sequence in S. saprophyticus WalK through sequence alignment with S. aureus and S. mutans WalK

  • Generate point mutations in the tryptophan residue and surrounding acidic amino acids

  • Assess effects on:

    • WalK-WalR interaction using split luciferase complementation assays

    • Phosphotransferase activity using in vitro phosphorylation assays

    • Phosphatase activity using dephosphorylation assays with phosphorylated WalR

    • Bacterial phenotypes including growth, cell morphology, and uroadhesion properties

What methods can be used to study the potential of WalK as an antibiotic target in S. saprophyticus?

Since the WalRK system is essential in most Firmicutes, it represents an attractive antibiotic target . To evaluate WalK as a therapeutic target in S. saprophyticus:

  • Develop a high-throughput screening assay for WalK inhibitors:

    • ATP-competitive binding assays

    • Fluorescence resonance energy transfer (FRET) assays for WalK-WalR interaction

    • Reporter systems measuring WalR-dependent gene expression

  • Assess essential nature of WalK in S. saprophyticus:

    • Attempt creation of walK deletion mutants with complementation

    • Develop conditional expression systems to deplete WalK

    • Assess viability and virulence in WalK-depleted conditions

  • Test specificity of potential inhibitors:

    • Compare effects on bacterial vs. human kinases

    • Assess broad-spectrum activity against WalK from multiple Staphylococcus species

How does S. saprophyticus WalK differ from WalK in other staphylococcal species?

While specific comparisons require further research, important considerations include:

  • Sequence homology analysis of WalK across staphylococcal species

  • Comparison of sCache domain sequences to identify potential differences in ligand specificity

  • Analysis of WalR binding domains and phosphotransfer efficiency

  • Examination of the W-Acidic motif conservation

These differences may relate to S. saprophyticus' unique ecological niche as both a commensal organism in the gastrointestinal tract and a uropathogen .

What WalK-regulated genes might contribute to S. saprophyticus uropathogenicity?

In other staphylococci, the WalR regulon contains genes encoding cell wall hydrolases . In S. saprophyticus:

  • The WalK-WalR system likely regulates similar cell wall hydrolases

  • These enzymes may contribute to S. saprophyticus' ability to adhere to uroepithelial cells and persist in the urinary tract

  • WalK-regulated genes might be involved in the bacteria's resistance to urinary tract defense mechanisms

Methodological approach: Comparative transcriptomics and ChIP-seq analysis of wild-type and WalK mutant strains can help identify the WalR regulon in S. saprophyticus, particularly under conditions mimicking the urinary tract environment.

What challenges might I encounter when working with recombinant S. saprophyticus WalK and how can I overcome them?

Common challenges and solutions:

ChallengeSolution Strategy
Poor expression yieldOptimize codon usage for E. coli, reduce induction temperature (16-20°C), try different E. coli strains (C41/C43 for membrane proteins)
Protein instabilityInclude protease inhibitors, optimize buffer conditions, incorporate stabilizing agents such as glycerol
Inclusion body formationExpress at lower temperatures, use solubility-enhancing tags, try refolding protocols
Inconsistent phosphorylation activityEnsure proper divalent cation (Mg²⁺/Mn²⁺) concentration, verify protein folding by circular dichroism
Difficult WalR interactionEnsure both proteins are properly folded, optimize salt and pH conditions, consider adding crowding agents

How can I design sensitive assays to detect small molecule inhibitors of S. saprophyticus WalK?

For high-throughput screening of WalK inhibitors:

  • ADP-Glo™ Kinase Assay: Measures ADP production during kinase reaction

  • Time-resolved FRET (TR-FRET): Detects WalK-WalR interaction using fluorescently labeled proteins

  • Thermal shift assays: Monitors changes in protein thermal stability upon inhibitor binding

  • Surface plasmon resonance (SPR): Quantifies binding kinetics between WalK and potential inhibitors

  • Whole-cell reporter assays: Measures effects on WalR-regulated gene expression

These assays should be validated using positive controls such as known kinase inhibitors (e.g., staurosporine as a broad-spectrum kinase inhibitor) and negative controls (vehicle only).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.