Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor protein lytS (lytS)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Production

Recombinant LytS from S. saprophyticus is produced using baculovirus expression systems for high-fidelity protein synthesis. Key specifications include:

ParameterDetails
UniProt IDQ4A009
Gene NamelytS
Source OrganismStaphylococcus saprophyticus subsp. saprophyticus (ATCC 15305/DSM 20229)
Expression HostBaculovirus
Protein LengthPartial sequence (specific residues not specified in available data)
Purity>85% (determined by SDS-PAGE)
StorageLyophilized powder stable at -20°C/-80°C; reconstituted aliquots at 4°C
ReconstitutionRequires deionized water; glycerol (5–50%) recommended for long-term storage .

Biological Roles

  • Biofilm Regulation: In S. aureus, LytSR modulates biofilm integrity by controlling extracellular DNA (eDNA) release via the lrgAB operon .

  • Autolysis Control: LytSR influences murein hydrolase activity and cell lysis, critical for stationary-phase survival and antibiotic tolerance .

  • Metabolic Regulation: Transcriptional profiling in S. aureus links LytSR to carbohydrate and nucleotide metabolism genes .

Research Applications

Recombinant LytS is utilized in:

  • Mechanistic Studies: Investigating signal transduction pathways in S. saprophyticus .

  • Antimicrobial Development: Targeting biofilm-associated infections .

  • Structural Biology: Crystal structure determination to design kinase inhibitors .

Comparative Analysis with Staphylococcal LytS Homologs

FeatureS. saprophyticus LytS S. aureus LytS B. subtilis LytS
UniProt IDQ4A009P60614Q81HY6
Expression HostBaculovirusE. coliE. coli/Yeast
Key FunctionSignal transduction (inferred)Biofilm/eDNA regulation Cell lysis and division
Purity>85%>90%≥85%

Limitations and Future Directions

  • Partial Sequence: The recombinant S. saprophyticus LytS is truncated, limiting full functional studies .

  • Species-Specific Data: Most functional insights are extrapolated from S. aureus; direct validation in S. saprophyticus is needed.

  • Therapeutic Potential: Further research could explore LytS as a target for urinary tract infection treatments, given S. saprophyticus's clinical relevance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag.
Synonyms
lytS; SSP0464; Sensor protein LytS; Autolysin sensor kinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
lytS
Target Protein Sequence
MLNLFILLLERVGLIILIAYILMNINHFKTMMNEREKRRSQWQLIIIFGCFSMISNFTGI QIRGDEIINGTVYNHLDPDASLANTRVLTIGVSGLIGGPFVALAVAVISGMYRVYIGGAD AYIYLISSIFIALISGYFGYKAMRANRYPTIVKGACIGGTTEIIQMLCILLFSDNTEHAW TLVKLIAIPMISINSIGTAIFLSIILSTIKQEEETRAIQTHDVLQLANQTLPYFRSGLNE QSAKKAAEIILNLMRVSAVAITNRKDILTHVGVASDHHVAQKAIITNLSKRAIQSGTLKE AYSSEEIGCNHPGCPLEAAIVVPLRVKNDVVGTLKLYFTNKYDVNYSDKQLATGLAEIFS SQLELGQAETQSALIRDAEIKSLQAQVNPHFFFNAINTISALIRIDSEKARELLLQLSQF FRSNLQGARNNTISLEKELQQVESYLSLEQARYPDRFNVSFDIDRTCYGALVPPFAIQIL VENAIKHAFKNRKYNNEIIVKAHKAQTGLVISVSDNGHGIPYEKLDKIGKTSVHSESGTG SALENLNRRLDGLFGYEASLQIHSDHQGTQVSCTIPYHNLEEEKIESNHCR
Uniprot No.

Target Background

Function
This protein is a member of the two-component regulatory system LytR/LytS, which is believed to regulate genes involved in cell wall metabolism.
Database Links

KEGG: ssp:SSP0464

STRING: 342451.SSP0464

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the LytS protein in Staphylococcus saprophyticus and how does it function in bacterial signaling?

LytS is a membrane-bound histidine kinase that forms part of the LytSR two-component regulatory system in Staphylococcus saprophyticus. As a member of the LytS-type family, it typically contains a characteristic 5TMR-LYT domain (pfam07694) that anchors the protein to the bacterial membrane with multiple transmembrane helices . LytS functions as a sensor that detects specific environmental changes, such as alterations in membrane potential or extracellular metabolic signals, and converts these signals into phosphorylation events . Upon sensing its stimulus, LytS undergoes autophosphorylation and subsequently transfers the phosphate group to the response regulator LytR, which then modulates gene expression .

The structural organization of LytS typically includes an input domain containing the membrane-integrated region and a cytosolic portion with DHp (dimerization and histidine phosphotransfer) and CA (catalytic and ATP-binding) domains . In other staphylococcal species, the LytSR system has been shown to be widely conserved and plays critical roles in controlling cellular processes including autolysis, biofilm formation, and virulence .

How does LytS contribute to biofilm formation in staphylococcal species?

The LytSR system exerts substantial influence on biofilm development across various staphylococcal species through multiple mechanisms. In S. aureus, LytSR regulates the release of genomic DNA, which serves as a crucial structural component of the biofilm matrix . Interestingly, studies with a clinical S. aureus isolate (UAMS-1) revealed that a lytS knockout mutant formed a more adherent biofilm than wild-type strains, indicating complex regulatory dynamics .

The relationship between LytSR and biofilm formation appears to involve the regulation of autolysis. Biofilm production is closely related to bacterial autolysis, as extracellular DNA released following cell lysis contributes significantly to biofilm structure and integrity . In S. lugdunensis, deletion of lytSR affected biofilm formation, suggesting its involvement in this process .

The molecular mechanisms involve LytSR's control over the expression of the lrgAB operon and potentially the cidA gene, which together modulate cell death and lysis . These processes determine the release of extracellular DNA and other cellular components that form the biofilm matrix. Additionally, LytSR may regulate adhesion factors that facilitate initial attachment to surfaces, as evidenced by studies in S. lugdunensis showing that LytSR regulates genes encoding known colonization factors .

What is the genetic organization of the lytSR operon and its regulatory targets?

The lytSR operon typically consists of two adjacent genes encoding the sensor histidine kinase LytS and the response regulator LytR . These genes are co-transcribed and function together as a coordinated regulatory unit. In S. lugdunensis, experiments with the pMAD plasmid to create deletion mutants targeted regions upstream of lytS and downstream of lytR, indicating the organization of these genes in a single operon .

The primary regulatory target of the LytSR system is the lrgAB operon, which encodes a pore-forming holin and is conserved across multiple bacterial species including S. aureus, S. epidermidis, S. mutans, and B. subtilis . The LytR response regulator, which belongs to the family of LytTR-type response regulators, contains a LytR-type DNA-binding domain that is predicted to form a 10-stranded β-fold structure . This domain specifically recognizes and binds to promoter regions of target genes.

Microarray studies in S. lugdunensis revealed that deletion of lytSR affected the expression of 286 genes, indicating a broad regulatory impact . These genes were involved in:

  • Basic metabolic functions (amino acids, carbohydrates, and nucleotides metabolism)

  • Virulence and colonization factors (fibrinogen-binding protein Fbl, major autolysin AtlL)

  • The type VII secretion system

  • Cell wall maintenance and integrity

What are the optimal methods for expressing and purifying recombinant S. saprophyticus LytS protein?

Expressing and purifying membrane-integrated histidine kinases like LytS presents significant challenges due to their hydrophobic transmembrane domains. Based on methodologies used for similar proteins, the following protocol framework is recommended for S. saprophyticus LytS:

Expression System Selection:

  • E. coli BL21(DE3) strain is generally preferred for recombinant expression of bacterial histidine kinases .

  • For membrane proteins like LytS, specialized strains such as C41(DE3) or C43(DE3) that are adapted for membrane protein expression may yield better results.

Vector Design Considerations:

  • Construct a vector containing the lytS gene with a C-terminal His-tag or FLAG-tag for detection and purification purposes .

  • Include the native promoter and ribosome binding site (approximately 282 bp upstream of the lytS start codon) to maintain proper expression regulation .

  • For complementation studies, the entire lytSR operon including its predicted promoter should be amplified and cloned into an appropriate shuttle vector like pCU1 .

Expression Conditions:

  • Growth at lower temperatures (16-20°C) after induction reduces protein aggregation.

  • Induction with lower concentrations of IPTG (0.1-0.5 mM) promotes proper folding.

  • Addition of glycerol (5-10%) to the growth medium can stabilize membrane proteins.

Membrane Protein Extraction and Purification:

  • For functional studies of membrane-integrated LytS, isolate membrane fractions by differential centrifugation after cell lysis.

  • Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Verify membrane integration by SDS-PAGE and western blotting using an anti-tag antibody, as demonstrated for BtsS variants in E. coli .

Functional Validation:

  • Assess autophosphorylation activity using radioactive ATP (preferably Mn²⁺-ATP rather than Mg²⁺-ATP based on findings with the BtsS homolog) .

  • For studies requiring only the cytoplasmic portion, express the truncated protein lacking transmembrane domains to improve solubility.

What experimental approaches are most effective for studying LytS binding activity and signal transduction?

Investigating LytS binding activity and signal transduction requires a combination of molecular, biochemical, and genetic approaches:

Binding Activity Assessment:

  • Site-directed mutagenesis: Create point mutations in key residues suspected to be involved in ligand binding or signal transduction. For example, in the BtsS homolog in E. coli, mutations in Arg72, Arg99, Cys110, and Ser113 significantly affected pyruvate sensing . Similar amino acid residues could be targeted in S. saprophyticus LytS.

  • Reporter gene assays: Construct a luxCDABE reporter system fused to a gene known to be regulated by LytS/LytR (similar to the btsT::luxCDABE fusion used for BtsS) . This allows for measuring the activation of signal transduction in response to various stimuli.

  • Isothermal titration calorimetry (ITC): For determining binding affinities between purified LytS protein (or its sensing domain) and potential ligands.

Signal Transduction Analysis:

  • Phosphotransfer assays: Detect the transfer of phosphoryl groups from LytS to LytR using radioactively labeled ATP.

  • Differential gene expression analysis: Use RNA-seq or microarray analysis to identify genes differentially expressed between wild-type and lytS mutant strains, similar to the approach used in S. lugdunensis that identified 286 affected genes .

  • Electrophoretic mobility shift assays (EMSAs): Examine LytR binding to the promoter regions of target genes to confirm direct regulation.

Stimulus Identification:
Since the specific stimulus for S. saprophyticus LytS is not definitively known, systematic testing of potential signals is necessary:

  • Test changes in membrane potential using membrane-depolarizing agents

  • Examine metabolic signals such as pyruvate, which activates the BtsS system in E. coli

  • Assess oxygen levels, glucose, and other metabolites as potential triggers

Structural Analysis:

  • For advanced studies, consider computational modeling based on homologous proteins to predict binding sites and then validate these through mutagenesis.

  • If resources permit, attempt crystallography of the sensing domain with and without ligands.

What challenges arise when constructing lytS mutants in S. saprophyticus and how can they be addressed?

Constructing lytS mutants in S. saprophyticus presents several technical challenges due to the organism's genetic characteristics and the nature of the LytSR system:

Challenge 1: Low Transformation Efficiency
S. saprophyticus, like other staphylococci, may exhibit low transformation efficiency with standard protocols.

Solution:

  • Use optimized electroporation protocols with specific parameters for S. saprophyticus

  • Consider protoplast transformation methods as used for S. lugdunensis DSMΔ lytSR

  • Pretreat cells with glycine (up to 5%) to weaken the cell wall before transformation

Challenge 2: Potential Essentiality or Growth Defects
If lytS is essential or its deletion causes severe growth defects, obtaining viable mutants may be difficult.

Solution:

  • Use inducible or repressible systems to control gene expression rather than complete deletion

  • Create conditional mutants using temperature-sensitive plasmids

  • Consider CRISPR interference (CRISPRi) to knockdown rather than knockout the gene

Challenge 3: Genetic Tools Limitation
The genetic tools optimized for S. saprophyticus may be limited compared to model organisms.

Solution:

  • Adapt plasmids used successfully in related species, such as the pMAD plasmid used for homologous recombination in S. lugdunensis

  • Design homologous recombination strategies targeting the upstream region of lytS and the downstream region of lytR using a two-step overlap PCR reaction

  • Verify constructs in E. coli before attempting transformation into S. saprophyticus

Challenge 4: Phenotype Verification
Confirming the phenotypic effects of lytS mutation requires appropriate assays.

Solution:

  • Establish robust complementation systems using shuttle vectors like pCU1 that can replicate in both E. coli and staphylococci

  • Include the entire lytSR operon with its native promoter and ribosome binding site for complementation

  • Develop specific assays for biofilm formation, autolysis, and virulence relevant to S. saprophyticus

Challenge 5: Polar Effects on Downstream Genes
Deleting lytS might affect the expression of lytR or other downstream genes.

Solution:

  • Use markerless deletion strategies that minimize disruption of operon structure

  • Create both single (lytS) and double (lytSR) mutants to distinguish between effects

  • Perform RT-PCR to verify expression levels of nearby genes in the mutant strains

What contradictions exist in the literature regarding LytS function and how might they be resolved?

Several notable contradictions and knowledge gaps exist in the literature regarding LytS function across bacterial species:

Contradiction 1: Effects on Biofilm Formation
In S. aureus, a lytS knockout mutant formed a more adherent biofilm than wild-type strains . This seems counterintuitive given that LytSR is known to control autolysis and DNA release, which typically contribute positively to biofilm formation.

Resolution Approaches:

  • Investigate strain-specific differences in biofilm regulation

  • Determine if compensatory mechanisms are activated in lytS mutants

  • Examine whether the increased adherence involves different matrix components

  • Analyze the expression of biofilm-related genes in both backgrounds

Contradiction 2: Role in Autolysis
In S. aureus, LytSR regulates genes that affect murein hydrolase activity , while in S. agalactiae, the ΔlytS mutant displayed a significantly lower rate of autolysis compared to the wild-type strain .

Resolution Approaches:

  • Compare the regulatory networks of LytSR across different species

  • Investigate differences in cell wall composition that might affect autolysis

  • Examine the expression and activity of specific autolysins in different species

  • Consider the evolutionary adaptation of the LytSR system to different ecological niches

Contradiction 3: Primary Signals Sensed by LytS
Different studies suggest that LytS responds to various signals including membrane potential changes and extracellular metabolites such as pyruvate, glucose, and oxygen .

Resolution Approaches:

  • Conduct systematic stimulus testing across different species

  • Perform comparative structural analysis of the sensing domains

  • Create chimeric proteins to identify signal-specific domains

  • Use advanced biosensors to monitor LytS activation in real-time under different conditions

Knowledge Gap: Species-Specific Functions
Limited information exists about the specific role of LytS in S. saprophyticus compared to other staphylococcal species.

Resolution Approaches:

  • Generate and characterize S. saprophyticus lytS mutants

  • Perform transcriptomic and proteomic analyses comparing S. saprophyticus with other staphylococci

  • Develop animal models specific to S. saprophyticus urinary tract infections to assess virulence

  • Investigate LytS function in the context of the urinary tract environment

How might the LytS protein be targeted for antimicrobial development against S. saprophyticus infections?

Given the importance of the LytSR system in bacterial physiology and virulence, targeting LytS represents a promising approach for developing novel antimicrobials against S. saprophyticus infections:

Strategy 1: Inhibition of Sensor Domain Function
Targeting the ligand-binding pocket of LytS could prevent signal detection and subsequent activation of the response pathway.

Methodological Approach:

  • Identify critical residues in the sensor domain using homology modeling based on the BtsS structure where Arg72, Arg99, Cys110, and Ser113 were found crucial for ligand binding

  • Design small molecule inhibitors that compete with natural ligands

  • Use high-throughput screening of compound libraries against purified sensor domains

  • Validate hits using reporter gene assays and in vitro binding assays

Strategy 2: Disruption of Histidine Kinase Activity
Inhibiting the ATP-binding domain or the phosphotransfer reaction would block signal transduction.

Methodological Approach:

  • Target the ATP-binding pocket with analogs that compete with ATP

  • Develop compounds that stabilize inactive conformations of the kinase

  • Screen for molecules that prevent dimerization, which is often essential for kinase activity

  • Use structure-based drug design to optimize lead compounds

Strategy 3: Interference with LytS-LytR Interaction
Blocking the interaction between LytS and LytR would prevent phosphotransfer and downstream signaling.

Methodological Approach:

  • Identify the interaction surfaces using protein-protein interaction studies

  • Design peptide inhibitors based on the binding interface

  • Perform fragment-based screening to identify small molecules that disrupt the interaction

  • Validate candidates using phosphotransfer assays

Strategy 4: Exploitation of LytS-Regulated Processes
Instead of directly targeting LytS, this approach would manipulate processes regulated by the LytSR system.

Methodological Approach:

  • Develop compounds that trigger premature activation of autolysis

  • Design agents that disrupt biofilm formation by interfering with LytSR-regulated matrix components

  • Target specific virulence factors under LytSR control

  • Create combination therapies that exploit altered antibiotic susceptibility in cells with disrupted LytSR function

Translational Potential and Considerations:
The involvement of LytSR in controlling autolysis and biofilm formation in staphylococci suggests that LytS inhibitors might be particularly effective against biofilm-associated infections . Since S. saprophyticus is a common cause of urinary tract infections , developing urinary tract-specific delivery systems for these inhibitors could enhance their efficacy while minimizing systemic effects.

Additionally, given that the LytSR system affects antibiotic tolerance in some staphylococcal species , LytS inhibitors might synergize with conventional antibiotics, potentially resensitizing resistant strains or preventing the development of resistance. This combination approach could be particularly valuable given the increasing prevalence of antibiotic resistance among uropathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.