Recombinant Staphylococcus saprophyticus subsp. saprophyticus Serine protease htrA-like (SSP1763)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
SSP1763; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-597
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
SSP1763
Target Protein Sequence
MANDKKHVIPREKYGRKRREYFHNEEREQRVQMERKARKQRAEKAEKLAKNNEERVKENL RKARIEKLTQEEIQQQQAMATKRNSSNSESEFEPSEDNALNHVSKQQPEEVSPTSDIAKD DVEVASTTNETNGYLKTNEISNDSDIDVNASTNKDRLHDDYFYSEEAQQSRVNQYIEEDN SDKVHNNIARNHKSGQTDDKSDQHRHSDQPTLIDKVKYFFKEHWAKVLIVLAVILLIVLI NAIFNNVDHNGNTKDNIFQSSDNANKEKTYTDTMKSANSAIHSIVTVENDTSNNSSSAEK ETQEAGKENELGSGVVYKKVGDSIFIMTNAHVVGDKKEQKITYGNNDTSIGKVIGTDKFS DIAVVKTKIKSGSDVKSIKMGDSSTLVLGEPIIVVGNPLGVDFKGSVSEGIVSGLNRHVP VDIDKDNQYDVLMSAFQMDAPVNPGNSGGGVIDKNGKLIGIASLKIDMDHVEGIAFAIPV NDAESIAKQLEAKGEVKYPNTGIKIANVKDMDEATHQSLNLPEEVNKGVVIGDVKDNSLG EKSGLQKNDVIVELDGKEVEDNLRYRQIIFSHKDDLDTLPAKIYRDGKEQDIKIKLK
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP1763

STRING: 342451.SSP1763

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of HtrA-like serine proteases in Staphylococcus species?

HtrA-like serine proteases represent a highly conserved family of surface proteases present across bacteria, yeasts, plants, and humans. In Staphylococcus species, these proteases serve as housekeeping proteases responsible for the degradation of abnormal or damaged proteins produced during thermal or oxidative stress . The HtrA-like serine protease in Staphylococcus saprophyticus subsp. saprophyticus (SSP1763) contains 597 amino acids with a molecular structure that includes specific functional domains essential for its proteolytic activity .

The protein exhibits a characteristic structure with several key regions:

  • N-terminal sequence containing transmembrane regions

  • Catalytic domain with the serine protease active site

  • PDZ domains involved in substrate recognition and binding

The primary functions of HtrA-like proteases include:

  • Degradation of periplasmic abnormal proteins

  • Elimination of damaged proteins during thermal or oxidative stress

  • Chaperone activity at low growth temperatures

  • Potential involvement in bacterial virulence mechanisms

How does Staphylococcus saprophyticus SSP1763 differ from HtrA proteases in other Staphylococcus species?

The Staphylococcus saprophyticus SSP1763 serine protease shares structural homology with other HtrA-like proteases but possesses distinct characteristics. Unlike Staphylococcus aureus, which encodes two HtrA-like proteases (HtrA1 and HtrA2), S. saprophyticus contains the SSP1763 gene encoding a single HtrA-like protease with unique properties .

Key differences include:

  • Amino acid sequence variations, particularly in substrate-binding regions

  • Unique expression patterns in response to environmental stressors

  • Distinctive substrate specificity profiles

  • Potentially different roles in pathogenicity mechanisms

The full-length SSP1763 protein contains transmembrane regions that anchor it to the bacterial surface, along with specific domains that facilitate its protease and potential chaperone functions . Comparative analysis with S. aureus HtrA proteins suggests potential functional differences, as evidenced by the strain-specific roles observed in S. aureus HtrA1 and HtrA2 .

What methodologies are most effective for generating mutant strains to study SSP1763 function?

Based on established protocols for HtrA-like proteases in related staphylococcal species, several methodological approaches can be employed to generate SSP1763 mutants:

Gene Interruption Strategy:

  • Amplify an internal fragment of the SSP1763 gene using PCR with specific primers targeting conserved regions

  • Clone the fragment into a suitable vector (e.g., pCRII-TOPO)

  • Insert an antibiotic resistance marker (e.g., chloramphenicol resistance gene cat) into the cloned fragment

  • Transform the construct into S. saprophyticus cells and select for antibiotic-resistant transformants

Gene Replacement Strategy:

  • Create a construct containing the SSP1763 gene with an internal deletion

  • Replace the deleted region with an antibiotic resistance marker (e.g., spectinomycin resistance gene spc)

  • Clone the disrupted gene into a temperature-sensitive vector (e.g., pMAD)

  • Introduce the vector into S. saprophyticus cells and select for double-crossover events using temperature shifts and antibiotic selection

Verification of mutants should include PCR confirmation, Southern blotting, and expression analysis to ensure proper gene disruption .

How do strain backgrounds affect the phenotypic expression of HtrA-like protease mutations?

Research on S. aureus HtrA proteases demonstrates significant strain-dependent variations in phenotype when these proteases are mutated. This finding has critical implications for SSP1763 research in S. saprophyticus .

Strain-Specific Effects Observed in S. aureus:

StrainHtrA1 Mutation EffectsHtrA2 Mutation EffectsDouble Mutation Effects
RN6390Sensitivity to puromycin-induced stressMinimal phenotypeAffected expression of secreted virulence factors; Loss of agr RNA III transcript; Reduced virulence in endocarditis model
COLEssential for thermal stress survivalEssential for thermal stress survivalNo significant effect on virulence in endocarditis model

These strain-specific differences likely result from variations in genetic background affecting:

  • Regulatory networks controlling virulence factor expression

  • Stress response mechanisms

  • Compensatory mechanisms for protease function

  • Interactions with other cellular components

For SSP1763 research, these findings suggest that:

  • Multiple strain backgrounds should be tested when characterizing mutant phenotypes

  • Complementation studies should be performed to confirm gene-phenotype relationships

  • Regulatory context should be considered when interpreting results

  • Potential redundancy in protease functions should be investigated

What expression systems are optimal for producing recombinant SSP1763 for functional studies?

Based on established protocols for similar HtrA-like proteases, several expression systems can be employed:

E. coli Expression System:

  • Clone the full-length or catalytic domain of SSP1763 into vectors like pET or pGEX

  • Express with affinity tags (His-tag, GST) for purification

  • Optimize expression conditions (temperature, IPTG concentration)

  • Consider codon optimization for improved expression levels

Conditional Expression in Staphylococcal Species:

  • Utilize systems similar to those employed for S. aureus HtrA1/HtrA2

  • The pMAD vector system allows temperature-controlled expression

  • Complementation of HtrA-deficient Lactococcus lactis can be used to assess functionality

Expression Considerations:

  • Express without the transmembrane domain for improved solubility

  • Use mild induction conditions to prevent inclusion body formation

  • Consider fusion partners that enhance solubility

  • Include protease inhibitors during purification to prevent self-cleavage

The recombinant SSP1763 protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for up to one week .

How can researchers effectively assess the dual protease and chaperone activities of SSP1763?

Based on methodologies employed for other HtrA-like proteases, a comprehensive approach to characterizing both protease and chaperone activities includes:

Protease Activity Assessment:

  • Substrate Specificity Analysis:

    • Utilize synthetic peptides containing preferred cleavage sites

    • Employ fluorogenic substrates for quantitative assays

    • Monitor cleavage using SDS-PAGE, HPLC, or mass spectrometry

  • Stress-Induced Protein Degradation:

    • Expose bacterial cultures to various stressors (heat, oxidative agents)

    • Analyze protein degradation patterns in wild-type versus SSP1763 mutants

    • Identify accumulated substrates in mutant strains

Chaperone Activity Assessment:

  • Thermal Aggregation Prevention:

    • Monitor the ability of SSP1763 to prevent aggregation of model substrates

    • Assess temperature-dependent shifts between protease and chaperone functions

    • Compare activities at different temperatures (low temperatures favor chaperone activity)

  • Complementation Studies:

    • Express SSP1763 in L. lactis HtrA-deficient strains sensitive to thermal stress

    • Assess restoration of thermotolerance

    • Compare with known chaperones as positive controls

Integration of Activities:

  • Investigate how these dual functions coordinate in vivo

  • Assess how environmental conditions shift the balance between protease and chaperone activities

  • Determine if specific domains are responsible for each function

What experimental approaches can determine the role of SSP1763 in stress response and bacterial survival?

To investigate SSP1763's role in stress response and survival, researchers should consider the following methodological approaches:

Stress Challenge Assays:

  • Thermal Stress:

    • Compare growth of wild-type and SSP1763 mutant strains at elevated temperatures

    • Analyze survival rates after heat shock treatment

    • Assess recovery time following thermal stress

  • Oxidative Stress:

    • Challenge bacteria with hydrogen peroxide, superoxide generators, or NO donors

    • Measure viability using colony counting or viability dyes

    • Monitor expression of oxidative stress response genes

  • Chemical Stressors:

    • Test sensitivity to antimicrobial peptides, antibiotics (e.g., puromycin), and other chemical stressors

    • Determine minimum inhibitory concentrations

    • Assess morphological changes under stress conditions

Regulatory Network Analysis:

  • Transcriptome Profiling:

    • Compare gene expression profiles of wild-type and mutant strains under different stress conditions

    • Identify genes with altered expression in the absence of SSP1763

    • Look for connections to known stress response pathways

  • Protein Interaction Studies:

    • Identify potential interaction partners using pull-down assays

    • Map regulatory networks affected by SSP1763

    • Examine effects on global regulators like agr or SarA homologs

In Vivo Survival Models:

  • Assess bacterial persistence in appropriate infection models

  • Compare wild-type and mutant strains for colonization ability

  • Investigate strain-specific differences in survival and virulence

What are the critical gaps in understanding SSP1763 function that warrant further investigation?

Several critical knowledge gaps should be addressed in future SSP1763 research:

Substrate Identification and Specificity:

  • Comprehensive identification of natural substrates in S. saprophyticus

  • Determination of cleavage site preferences

  • Comparison with substrate profiles of other HtrA-like proteases

Regulatory Network Integration:

  • Mapping the complete regulatory networks involving SSP1763

  • Understanding how environmental signals modulate SSP1763 activity

  • Identifying transcriptional and post-translational regulatory mechanisms

Structural Biology:

  • Obtaining high-resolution structures of SSP1763

  • Elucidating the molecular basis for the switch between protease and chaperone functions

  • Identifying structural features unique to Staphylococcus saprophyticus SSP1763

Strain-Specific Variations:

  • Characterizing SSP1763 variants across different S. saprophyticus isolates

  • Determining if function varies between clinical and environmental strains

  • Investigating potential correlations with pathogenicity or host adaptation

How can comparative analyses between different staphylococcal HtrA proteases advance SSP1763 research?

Comparative analyses between staphylococcal HtrA proteases offer valuable insights for SSP1763 research:

Evolutionary Conservation and Divergence:

  • Phylogenetic analysis of HtrA proteases across staphylococcal species

  • Identification of conserved functional domains versus species-specific adaptations

  • Correlation of sequence variations with functional differences

Functional Complementation Studies:

  • Express SSP1763 in S. aureus HtrA1/HtrA2 mutants

  • Determine if SSP1763 can rescue phenotypes of HtrA-deficient strains

  • Identify species-specific substrates versus conserved targets

Regulatory Network Comparison:

  • Compare how HtrA proteases integrate into regulatory networks across species

  • Identify conserved versus species-specific regulatory mechanisms

  • Understand how genetic background influences HtrA function

Pathogenicity Mechanisms:

  • Compare roles in virulence across different staphylococcal species

  • Identify common mechanisms versus species-specific adaptations

  • Develop unified models of HtrA function in pathogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.