Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0344 protein SSP1805 (SSP1805)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0344 Protein SSP1805 (SSP1805)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0344 protein SSP1805 (SSP1805) is a synthetic version of a bacterial protein produced via recombinant DNA technology. It is derived from the Staphylococcus saprophyticus subsp. saprophyticus strain ATCC 15305/DSM 20229 and corresponds to the gene SSP1805 (Uniprot ID: Q49WA9). While its specific biological function remains classified as "hypothetical," it is commercially available for research applications, including immunological assays and structural studies .

Key Features

PropertyDetailsSource
Gene OriginSSP1805 (Ordered Locus Name: SSP1805)
Protein Length129 amino acids (AA sequence provided in )
Host SystemsExpressed in E. coli, yeast, baculovirus, or mammalian cells
Purity≥85% as determined by SDS-PAGE
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (avoid repeated freeze-thaw cycles; working aliquots at 4°C)

The protein’s AA sequence (partial) reveals hydrophobic regions (e.g., "mLHMHIASWVLLIILFFAAYFNFSEKQGASPYFKPIHmLLRLFmLLVLISGFWVWIQSFS SGAAGGHmLLTLKMICGVAVVALMEVTITKRKKGQPSHGLMWTTIVVIILTMIIGIILPM GPITQMFGL"), suggesting potential membrane association or interaction with lipid environments .

Potential Biological Roles

While direct functional evidence for SSP1805 is lacking, S. saprophyticus is known for:

  1. Biofilm Formation: Over 90% of clinical isolates produce biofilms, primarily composed of proteins or protein-DNA-polysaccharide matrices .

  2. Surface-Associated Proteins: The species produces virulence factors like Ssp (a lipase) and Aas (autolysin adhesin), which mediate adhesion and pathogenicity .

SSP1805 may share functional homology with these proteins, though its specific role in biofilm formation, adherence, or immune evasion remains uncharacterized.

Comparative Analysis with Related Proteins

ProteinFunction/RoleKey Distinction from SSP1805Source
Ssp (Lipase)Surface-associated lipase; linked to virulence in UTIsEncodes enzymatic activity; SSP1805 lacks confirmed enzymatic domains
Aas (Autolysin)Adhesin involved in host matrix bindingMediates adherence; SSP1805 not tested for adhesion
IcaADBCR (Biofilm)Polysaccharide intercellular adhesin (PIA) synthesisBiofilm-related; SSP1805 not linked to ica cluster

Unresolved Questions

  1. Functional Annotation: SSP1805 is annotated as a hypothetical protein due to insufficient experimental evidence.

  2. Pathogenicity Role: No studies directly link SSP1805 to biofilm formation, immune evasion, or host interaction.

  3. Evolutionary Context: Unlike the ica cluster (acquired via horizontal gene transfer in S. saprophyticus), SSP1805’s origin and niche specificity are unclear .

Proposed Research Priorities

  • Structural Studies: Crystallography or NMR to elucidate tertiary structure.

  • Functional Screens: Knockout mutants in S. saprophyticus to assess phenotypic changes (e.g., biofilm defects).

  • Immune Response Profiling: Use ELISA to correlate SSP1805 antibodies with clinical outcomes in UTIs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
SSP1805; UPF0344 protein SSP1805
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
SSP1805
Target Protein Sequence
MLHMHIASWVLLIILFFAAYFNFSEKQGASPYFKPIHMLLRLFMLLVLISGFWVWIQSFS SGAAGGHMLLTLKMICGVAVVALMEVTITKRKKGQPSHGLMWTTIVVIILTMIIGIILPM GPITQMFGL
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP1805

STRING: 342451.SSP1805

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0344 protein SSP1805 and why is it classified as a hypothetical protein?

The UPF0344 protein SSP1805 is a protein from Staphylococcus saprophyticus subsp. saprophyticus that belongs to the UPF0344 protein family . It is classified as a hypothetical protein because its function has not been experimentally determined or verified, despite its sequence being identified through genomic sequencing. The protein is encoded by either the SSP1805 gene or alternatively designated as SSP_RS09070 in some genomic annotations . The classification as "hypothetical" indicates that while the open reading frame exists in the genome and is predicted to be expressed, the biological role of the resulting protein remains uncharacterized. Researchers studying hypothetical proteins typically employ a combination of bioinformatic analyses, structural predictions, and experimental approaches to elucidate their functions.

What expression systems are available for recombinant SSP1805 protein production?

Multiple expression systems are available for the recombinant production of SSP1805 protein, each offering distinct advantages for different research applications. These include:

  • Cell-free expression systems - Allow for rapid protein production without the constraints of cell viability, particularly useful for potentially toxic proteins .

  • E. coli-based expression - The most commonly used system, offering high yields and cost-effectiveness for basic structural and functional studies .

  • Yeast expression systems - Provide eukaryotic post-translational modifications while maintaining relatively high protein yields .

  • Baculovirus-infected insect cells - Offer complex eukaryotic protein processing capabilities suitable for proteins requiring specific modifications .

  • Mammalian cell expression - Provides the most sophisticated post-translational modification machinery, ideal for studying proteins in a context closer to higher organisms .

The selection of an expression system should be based on specific research objectives, required protein yield, post-translational modification needs, and downstream applications.

How should researchers validate the identity and quality of purified recombinant SSP1805?

Validation of recombinant SSP1805 should follow a multi-technique approach to ensure both identity and quality. Standard validation protocols include:

  • SDS-PAGE analysis to assess purity (target ≥85%) and apparent molecular weight .

  • Western blotting with antibodies against either the target protein or affinity tags.

  • Mass spectrometry (MS) for accurate molecular weight determination and peptide mapping.

  • Circular dichroism (CD) spectroscopy to verify proper protein folding.

  • Dynamic light scattering (DLS) to assess protein homogeneity and aggregation state.

A comprehensive validation table should include:

Validation MethodParameter MeasuredAcceptance Criteria
SDS-PAGEPurity, MWSingle dominant band at expected MW, ≥85% purity
Western BlotIdentityPositive signal at expected MW
Mass SpectrometryExact mass, peptide coverageMass within 0.1% of theoretical, ≥70% sequence coverage
Circular DichroismSecondary structureSpectrum consistent with predicted structure
DLSHomogeneityMonodisperse population, absence of large aggregates

Validation data should be thoroughly documented to ensure reproducibility across experiments and between different batches of the recombinant protein.

How might SSP1805 relate to S. saprophyticus virulence mechanisms?

To understand the potential role of SSP1805 in S. saprophyticus virulence, researchers must consider the broader context of this pathogen's virulence mechanisms. S. saprophyticus is known to cause urinary tract infections (UTIs) through several virulence factors, including urease, surface proteins, and D-serine-deaminase protein (DsdA) . Although SSP1805 is currently classified as a hypothetical protein, several experimental approaches can help determine its potential role in virulence:

  • Comparative proteomics between virulent strains (like 9325) and less virulent strains to assess SSP1805 expression levels .

  • Interaction studies with known virulence factors or regulatory systems.

  • Knockout or knockdown studies to observe phenotypic changes in virulence-associated behaviors.

  • Host-pathogen interaction assays comparing wild-type and SSP1805-deficient strains.

Research on S. saprophyticus has demonstrated significant proteomic flexibility among different strains, which correlates with differences in virulence and persistence capabilities . If SSP1805 shows differential expression patterns between strains with varying virulence (such as strains 9325, 7108, and ATCC 15305), this could suggest a potential role in pathogenicity.

What methodologies are most appropriate for determining protein-protein interactions involving SSP1805?

Elucidating the protein-protein interactions of SSP1805 is crucial for understanding its biological function. Multiple complementary approaches should be employed:

  • Affinity-based methods:

    • Co-immunoprecipitation (Co-IP) with tagged SSP1805

    • Pull-down assays with GST or His-tagged SSP1805

    • Proximity-dependent biotin identification (BioID)

  • Biophysical techniques:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Microscale thermophoresis (MST)

  • Crosslinking approaches:

    • Chemical crosslinking followed by MS (XL-MS)

    • Photo-affinity labeling

  • Library screening methods:

    • Yeast two-hybrid (Y2H) screening

    • Bacterial two-hybrid screening

    • Phage display

For a comprehensive interaction study, researchers should develop a hierarchical workflow beginning with high-throughput screening methods followed by validation using multiple orthogonal techniques. This approach minimizes false positives while providing quantitative interaction parameters.

When publishing interaction data, tables should include the following:

Interacting PartnerDetection MethodInteraction ParametersBiological Significance
Protein XY2H, Co-IP, SPRKd = xx μM, StoichiometryPotential role in function Y
Protein ZBioID, SPRKd = xx μMSuggests involvement in process Z

How can researchers design experiments to determine if SSP1805 functions within a regulatory network?

Bacterial regulatory networks are complex and often involve two-component systems, transcription factors, and other regulatory elements. To determine if SSP1805 functions within such networks:

  • Transcriptomic analysis:

    • RNA-seq comparing wild-type and SSP1805 knockout strains

    • qPCR validation of differentially expressed genes

  • Chromatin immunoprecipitation (ChIP) approaches:

    • ChIP-seq to identify potential DNA binding if SSP1805 has DNA-binding domains

    • ChIP-qPCR for targeted analysis of specific promoter regions

  • Reporter gene assays:

    • Construction of promoter-luciferase fusions for potential target genes

    • Analysis of expression in response to SSP1805 levels

  • Gel-shift assays:

    • Electrophoretic mobility shift assays (EMSA) to detect direct DNA binding

    • Competition assays to determine binding specificity

A methodical approach would involve first identifying whether SSP1805 expression correlates with known regulatory systems in S. saprophyticus. For example, in S. aureus, regulatory proteins like SA1804 work in conjunction with two-component systems like SaeRS to regulate virulence factors . Similar regulatory relationships might exist for SSP1805 in S. saprophyticus.

What is the optimal experimental design for creating and validating an SSP1805 knockout strain?

Creating and validating an SSP1805 knockout strain requires a systematic approach to ensure the specificity of the genetic modification and proper phenotypic characterization:

  • Knockout strategy selection:

    • Allelic replacement via homologous recombination

    • CRISPR-Cas9 genome editing

    • Transposon mutagenesis (less specific)

  • Validation of genetic modification:

    • PCR verification of the modified genomic region

    • Whole-genome sequencing to confirm absence of off-target effects

    • RT-qPCR to confirm absence of SSP1805 transcript

    • Western blotting to confirm absence of SSP1805 protein

  • Complementation studies:

    • Reintroduction of SSP1805 gene via plasmid expression

    • Verification of phenotype restoration

  • Phenotypic characterization:

    • Growth curves under various conditions

    • Virulence assays (cell invasion, macrophage survival)

    • Biofilm formation capacity

    • Comparative proteomics

A validation table for the knockout strain should document:

Validation ParameterMethodExpected Result in WTExpected Result in KnockoutExpected Result in Complemented Strain
SSP1805 genePCRPresentAbsent/ModifiedPresent (plasmid)
SSP1805 transcriptRT-qPCRDetectableUndetectableDetectable
SSP1805 proteinWestern blotDetectableUndetectableDetectable
Growth rateGrowth curveBaselinePotential differenceSimilar to WT
Virulence phenotypeInvasion assayBaselinePotential differenceSimilar to WT

How should researchers design experiments to investigate SSP1805's potential role in biofilm formation?

Given that S. saprophyticus strains show variable biofilm formation capabilities , investigating SSP1805's potential role in this process is scientifically relevant. A comprehensive experimental design would include:

  • Comparative expression analysis:

    • qPCR measurement of SSP1805 expression in planktonic versus biofilm growth

    • Proteomic analysis of biofilm versus planktonic cells, focusing on SSP1805 abundance

  • Phenotypic analysis of SSP1805 knockout:

    • Quantitative biofilm assays using crystal violet staining

    • Confocal laser scanning microscopy (CLSM) of biofilm architecture

    • Flow cell biofilm formation analysis

    • Measurement of extracellular polymeric substance (EPS) production

  • Biofilm formation under varying conditions:

    • Nutrient limitation

    • Subinhibitory antibiotic concentrations

    • Environmental stressors (pH, temperature)

    • Host-relevant conditions (artificial urine medium)

  • Molecular interactions within biofilms:

    • Co-immunoprecipitation to identify interaction partners in biofilm vs. planktonic states

    • Localization studies using fluorescently tagged SSP1805

Results should be presented in tables comparing the wild-type, knockout, and complemented strains:

Biofilm ParameterMeasurement MethodWT StrainSSP1805 KnockoutComplemented Strain
Biofilm biomassCrystal violet assay (OD570)BaselineHigher/Lower/SameSimilar to WT
EPS productionCarbohydrate/protein quantificationBaselineHigher/Lower/SameSimilar to WT
Biofilm architectureCLSM (thickness, roughness)BaselineDetailed differencesSimilar to WT
Antibiotic toleranceMinimal biofilm eradication concentrationBaselineHigher/Lower/SameSimilar to WT

What proteomic approaches can be used to study SSP1805 in the context of S. saprophyticus virulence?

Proteomic analysis provides valuable insights into the expression, localization, and interactions of proteins like SSP1805. For studying SSP1805 in the context of virulence, researchers should consider:

  • Comparative proteomics:

    • Comparison between virulent and less virulent strains (e.g., 9325 vs. 7108)

    • Analysis of different growth conditions (planktonic, biofilm, host-mimicking)

    • Temporal analysis during infection process

  • Subcellular fractionation:

    • Separate analysis of cytoplasmic, membrane, and secreted fractions

    • Localization of SSP1805 in different cellular compartments

  • Post-translational modification (PTM) analysis:

    • Phosphoproteomics to detect phosphorylation events

    • Other PTM analyses as relevant (glycosylation, acetylation)

  • Interaction proteomics:

    • Immunoprecipitation coupled with mass spectrometry (IP-MS)

    • Cross-linking MS for capturing transient interactions

    • Hydrogen-deuterium exchange MS for structural insights

An experimental design table should outline:

Proteomic ApproachSample TypesTechnical ParametersExpected Outcomes
Comparative proteomicsWT vs. Knockout, Various conditionsLC-MS/MS, 1% FDRDifferential protein expression profiles
Secretome analysisCulture supernatantsConcentration methods, LC-MS/MSIdentification of differentially secreted proteins
PhosphoproteomicsCell lysatesPhosphopeptide enrichment, LC-MS/MSPhosphorylation sites and affected pathways
Interaction analysisIP samplesCross-linking, LC-MS/MSProtein-protein interaction network

How should researchers interpret conflicting data regarding SSP1805 function across different experimental approaches?

Interpreting conflicting data is a common challenge in characterizing hypothetical proteins like SSP1805. A systematic approach includes:

  • Critical evaluation of methodological differences:

    • Assess variations in experimental conditions, strain backgrounds, and reagents

    • Evaluate the sensitivity and specificity of each method

    • Consider biological versus technical replicates

  • Hierarchical weighting of evidence:

    • In vivo studies generally provide more biologically relevant insights than in vitro studies

    • Direct biochemical evidence often outweighs correlative or computational predictions

    • Consider reproducibility across independent laboratories

  • Integration of multiple data types:

    • Create data integration tables comparing results across methods

    • Develop consensus models that accommodate seemingly contradictory results

    • Consider that proteins often have multiple functions in different contexts

  • Follow-up validation experiments:

    • Design experiments specifically to resolve contradictions

    • Use orthogonal approaches to verify key findings

    • Consider conditional or context-dependent effects

A data interpretation framework might look like:

FindingMethod 1 ResultMethod 2 ResultMethod 3 ResultConsensus Interpretation
SSP1805 role in virulencePositive correlationNo effectContext-dependentLikely conditional effect dependent on specific factors
SSP1805 localizationMembrane-associatedCytoplasmicBoth, depending on conditionsDynamic localization based on cellular state
Regulatory functionActs as activatorActs as repressorDifferent targetsDual regulatory role depending on target genes

What statistical approaches are most appropriate for analyzing SSP1805 knockout phenotype data?

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Inclusion of biological and technical replicates

    • Randomization and blinding where applicable

    • Appropriate controls (wild-type, complemented strain, empty vector)

  • Statistical tests for different data types:

    • Continuous variables (growth rates, biofilm biomass): t-tests or ANOVA with post-hoc tests

    • Survival data: Kaplan-Meier analysis with log-rank tests

    • Count data: Chi-square or Fisher's exact tests

    • Non-normally distributed data: Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis)

  • Multiple testing corrections:

    • Bonferroni correction for conservative approach

    • False Discovery Rate (FDR) methods for large-scale data

    • Indication of exact p-values rather than thresholds (p<0.05)

  • Data presentation guidelines:

    • Always include measures of central tendency with dispersion (mean ± standard deviation)

    • Include ranges for parameters like age and scores

    • Present both absolute numerical values and percentages

A statistical analysis plan should be documented as:

PhenotypeData TypeStatistical TestSample Size JustificationMultiple Testing Correction
Growth rateContinuousANOVA with Tukey's post-hocBased on power analysis (β=0.8, α=0.05)Bonferroni for family-wise comparisons
Invasion capacityCount dataChi-squareBased on previous studiesFDR correction
Survival in macrophagesTime-to-eventLog-rank testBased on previous studiesN/A (single comparison)

How can SSP1805 research contribute to understanding strain-specific differences in S. saprophyticus pathogenicity?

S. saprophyticus strains demonstrate significant phenotypic and proteomic differences that affect their virulence and persistence capabilities . Research on SSP1805 can provide valuable insights into these strain-specific differences through:

  • Comparative genomic and expression analyses:

    • Examination of SSP1805 sequence variations across clinical isolates

    • Correlation of expression levels with virulence phenotypes

    • Identification of strain-specific regulatory mechanisms controlling SSP1805

  • Functional studies across strain backgrounds:

    • Creation of SSP1805 knockouts in multiple strain backgrounds (e.g., ATCC 15305, 7108, 9325)

    • Comparison of phenotypic effects in different genetic backgrounds

    • Assessment of strain-specific interaction partners

  • Host-pathogen interaction studies:

    • Evaluation of SSP1805 contribution to macrophage survival in different strains

    • Assessment of epithelial cell invasion capacity and the role of SSP1805

    • Host response to different strains with and without SSP1805

A strain comparison table might present:

S. saprophyticus StrainSSP1805 Expression LevelVirulence PhenotypeMacrophage Survival RateBiofilm FormationEffect of SSP1805 Knockout
ATCC 15305 (reference)BaselineIntermediateIntermediate (similar to 9325)IntermediateTo be determined
7108 (non-capsular)Lower/Higher/SameLower virulenceLowest survival rateHighest abilityTo be determined
9325 (highly capsular)Lower/Higher/SameHighest virulenceHighest survival rateLowest abilityTo be determined

What are the most promising future research directions for understanding SSP1805 function?

Based on current knowledge of S. saprophyticus and hypothetical proteins like SSP1805, several promising research directions emerge:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine SSP1805 structure

    • Structure-function analysis to identify active sites or interaction domains

    • Molecular dynamics simulations to predict functional properties

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position SSP1805 within cellular pathways

    • Machine learning approaches to predict function from diverse data types

  • Host-pathogen interaction focus:

    • Investigation of SSP1805's role during different stages of infection

    • Identification of host targets or immune responses to SSP1805

    • Development of cell and animal models to study SSP1805 in vivo

  • Translational research potential:

    • Assessment of SSP1805 as a diagnostic biomarker for S. saprophyticus infections

    • Evaluation as a potential vaccine candidate if surface-exposed

    • Exploration as a drug target if essential for virulence

A research roadmap might be structured as:

Research PhaseKey QuestionsMethodological ApproachesExpected OutcomesTimeline
Structural characterizationWhat is the 3D structure? Are there known structural homologs?X-ray crystallography, Homology modelingStructural insights, Functional predictionsShort-term
Functional validationWhat pathways involve SSP1805? What phenotypes are affected by its absence?Knockouts, Comparative proteomics, Phenotypic assaysConfirmed biological role(s)Medium-term
Host-pathogen dynamicsHow does SSP1805 contribute to infection? Does it interact with host factors?Infection models, Interaction studiesUnderstanding of role in pathogenesisMedium to long-term
Translational applicationsCan SSP1805 be targeted for diagnostics or therapeutics?Biomarker studies, Inhibitor screeningPotential clinical applicationsLong-term

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.