Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0365 protein SSP1183 (SSP1183)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0365 protein SSP1183 (SSP1183)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0365 protein SSP1183, referred to as SSP1183, is a protein derived from the bacterium Staphylococcus saprophyticus subsp. saprophyticus . SSP1183 is also known as Flotillin-like protein FloA .

Characteristics of SSP1183

SSP1183 is a protein that belongs to the UPF0365 protein family . It is expressed in E. coli as a full-length protein consisting of 327 amino acids with an N-terminal His tag . The molecular weight of the protein is approximately 73.5 kDa . SSP1183 is cell wall-anchored and associated with resistance to linoleic acid .

Table 1: Properties of Recombinant SSP1183

PropertyDescription
SpeciesStaphylococcus saprophyticus subsp. saprophyticus
SourceE. coli
TagHis
Protein LengthFull Length (1-327 amino acids)
FormLyophilized powder
Amino Acid SequenceMIGLIIIVVIVLVALLLLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVISPLIKAHKAGLHLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSTIGSSEHHTQVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALADKNIAQAKAEERRAMAVAQEQEMKAKVQEMRSKVVEAEAEVPLAMAEALRSGNLGVKDYYNLKNVEADTGMRNSINQRTNQKDDESPDK
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameSSP1183
SynonymsfloA; SSP1183; Flotillin-like protein FloA
UniProt IDQ49Y16

Function and Role of SSP1183

SSP1183 contributes to the bacterium's resistance against antibacterial effects of linoleic acid, an unsaturated free fatty acid . Linoleic acid disrupts bacterial cell membranes, and SSP1183 provides a defense mechanism against this disruption .

SSP1183 in Urinary Tract Infections (UTIs)

Staphylococcus saprophyticus is a common cause of community-acquired urinary tract infections (UTI) . SSP1183 is highly prevalent in clinical isolates of S. saprophyticus .

Potential Drug Target

In silico subtractive proteomics approaches have identified potential drug targets in S. saprophyticus, which could aid in developing new drugs against this bacterium .

Lipase Activity

SSP1183 has lipase activity, which can be observed on tributyrylglycerol agar plates . Mutants lacking SSP1183 do not show lipase activity, but the activity can be restored by reintroducing the gene .

Genetic Features

The sssF gene, encoding SSP1183, is often located on plasmids such as pSSAP2 in S. saprophyticus strains . These plasmids often have a mosaic structure with multiple insertions and deletions of sequence blocks .

Table 2: Plasmids and Genes Associated with SSP1183

FeatureDescription
sssF geneEncodes SSP1183, contributing to linoleic acid resistance
pSSAP2 plasmidContains the repA gene and a region sharing high nucleotide identity with the chromosome of S. saprophyticus ATCC 15305; also contains genes of unknown function and enzymes of the ribulose monophosphate pathway

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; SSP1183; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
SSP1183
Target Protein Sequence
MIGLIIIVVIVLVALLLLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVISPLI KAHKAGLHLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLEAV QMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSTI GSSEHHTQVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALADK NIAQAKAEERRAMAVAQEQEMKAKVQEMRSKVVEAEAEVPLAMAEALRSGNLGVKDYYNL KNVEADTGMRNSINQRTNQKDDESPDK
Uniprot No.

Target Background

Function
Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0365 protein SSP1183 (SSP1183) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. These FMMs are highly dynamic and increase in number with cellular aging. Flotillins are believed to play a crucial role in regulating membrane fluidity.
Database Links

KEGG: ssp:SSP1183

STRING: 342451.SSP1183

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Membrane raft; Single-pass membrane protein.

Q&A

What is UPF0365 protein SSP1183?

UPF0365 protein SSP1183 is a bacterial protein expressed by Staphylococcus saprophyticus subspecies saprophyticus, a gram-positive bacterium frequently associated with urinary tract infections. This protein belongs to the UPF0365 family, a group of proteins with uncharacterized functions. The protein is identified in the reference strain ATCC 15305 / DSM 20229 and has the UniProt accession number Q49Y16 . The full amino acid sequence consists of 181 amino acids with specific structural characteristics suggesting potential membrane association and bacterial cell surface expression patterns that may contribute to the organism's pathogenicity profile .

What expression systems are most suitable for recombinant UPF0365 protein SSP1183 production?

Multiple expression systems can be employed for recombinant SSP1183 production, each with distinct advantages. Escherichia coli and yeast expression systems typically provide the highest protein yields with relatively short turnaround times, making them cost-effective for initial characterization studies . Alternatively, insect cell expression using baculovirus vectors or mammalian cell expression systems can facilitate proper post-translational modifications that may be critical for protein folding and retention of biological activity . The selection of an appropriate expression system should be guided by the specific research objectives, particularly whether native post-translational modifications are essential for the functional assays being conducted.

How does strain variation affect UPF0365 protein expression in S. saprophyticus?

Strain variation significantly impacts protein expression profiles in S. saprophyticus, including UPF0365 protein expression. Proteomic analyses of different S. saprophyticus strains (ATCC 15305, 7108, and 9325) have revealed considerable flexibility in their proteome content, particularly related to virulence factors . While specific data on UPF0365 protein expression across these strains is limited, the documented proteomic flexibility suggests strain-specific regulation likely occurs. This variation reflects broader adaptations that influence the bacteria's capacity to survive during host-pathogen interactions, with some strains demonstrating enhanced virulence capabilities while others show increased biofilm formation potential .

How should I design experiments to study UPF0365 protein SSP1183 function?

When designing experiments to investigate SSP1183 function, a systematic approach incorporating multiple complementary methodologies is essential. Begin by clearly defining your research question and hypothesis based on preliminary data or bioinformatic predictions of protein function. The experimental design should include appropriate controls, multiple biological replicates, and consideration of variables that might influence protein function . For instance, when studying potential membrane-associated functions suggested by the protein's amino acid sequence, experiments should control for lipid composition, temperature, and ionic conditions.

A comprehensive experimental design table should include:

ComponentSpecification
Independent VariableConcentration of SSP1183 protein, presence of potential interacting partners, or environmental conditions
Dependent VariableMeasurable outcome (enzymatic activity, binding affinity, membrane integrity, etc.)
Control GroupsNegative control (buffer only), positive control (known protein with similar function)
Controlled VariablesTemperature, pH, buffer composition, incubation time
Number of ReplicatesMinimum 3 biological replicates with 3 technical replicates each
Statistical AnalysisAppropriate tests based on data distribution (t-test, ANOVA, etc.)

What controls should be implemented when characterizing UPF0365 protein SSP1183?

Implementing rigorous controls is essential for reliable characterization of UPF0365 protein SSP1183. For expression studies, include strain-specific controls by comparing protein expression in different S. saprophyticus strains such as the reference strain ATCC 15305, non-capsular strain 7108, and highly capsular strain 9325 . These distinct strains exhibit different proteomic profiles that affect virulence and persistence mechanisms. For functional assays, include negative controls (buffer or irrelevant protein of similar size) and positive controls (proteins with known similar functions if available).

When studying potential roles in virulence, experimental controls should include assessments of host cell interaction with wild-type bacteria versus strains with modified SSP1183 expression levels. The methodological quality should address common deficits observed in similar research, such as implementing blinded data collection, adequate power analyses, and systematic assessment of potential adverse events . Additionally, experiments should control for post-translational modifications that might influence protein activity by comparing recombinant protein expressed in different systems (bacterial versus mammalian) .

How can I optimize purification methods for UPF0365 protein SSP1183?

Optimization of SSP1183 purification requires careful consideration of the protein's physicochemical properties. Based on its amino acid sequence (MIGLIIIVVIVLVALLLLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVISPLIKAHKAGLHLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSTIG), which contains hydrophobic regions suggesting membrane association, a multi-step purification strategy is recommended . Begin with appropriate cell lysis methods that effectively solubilize membrane-associated proteins, such as detergent-based extraction (using non-ionic detergents like Triton X-100 or n-dodecyl-β-D-maltoside).

For chromatographic purification, implement a sequential approach:

  • Initial capture using affinity chromatography (if the recombinant protein includes an affinity tag)

  • Intermediate purification via ion exchange chromatography based on the protein's theoretical isoelectric point

  • Polishing step utilizing size exclusion chromatography to separate aggregates and ensure monodispersity

Throughout the purification process, monitor protein integrity using SDS-PAGE and Western blotting. Assess functional activity at each purification stage to ensure the protein maintains its native conformation and biological activity. Storage conditions should be optimized as 50% glycerol in Tris-based buffer at -20°C for short-term storage or -80°C for extended periods to prevent repeated freeze-thaw cycles that could compromise protein integrity .

How does UPF0365 protein SSP1183 potentially contribute to S. saprophyticus virulence?

Although direct evidence specifically linking UPF0365 protein SSP1183 to virulence is limited in the available literature, broader proteomic analyses of S. saprophyticus strains provide valuable context for understanding potential contributions to pathogenicity. Comparative studies of strains with different virulence profiles (ATCC 15305, 7108, and 9325) have revealed that protein expression patterns significantly influence virulence capabilities . The highly capsular strain 9325 demonstrates enhanced survival during macrophage interaction, suggesting that membrane and surface-associated proteins play crucial roles in immune evasion strategies.

Based on the amino acid sequence of SSP1183 (MIGLIIIVVIVLVALLLLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVISPLIKAHKAGLHLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSTIG), which contains hydrophobic regions consistent with membrane localization , this protein may function in bacterial adherence, host cell interaction, or resistance to host defense mechanisms. Experimental approaches to investigate its role in virulence should include:

  • Gene knockout or silencing studies to assess changes in virulence phenotypes

  • Host-pathogen interaction assays comparing wild-type and mutant strains

  • Structural analysis to identify potential binding domains involved in host cell recognition

  • Comparative expression analysis during different stages of infection

What methodological approaches can assess UPF0365 protein SSP1183 interactions with host cells?

Investigating SSP1183 interactions with host cells requires robust methodological approaches that capture the complexity of host-pathogen interactions. Begin with binding assays using purified recombinant SSP1183 to identify potential host cell receptors or interaction partners. This can be accomplished through pull-down assays coupled with mass spectrometry, surface plasmon resonance for binding kinetics, or enzyme-linked immunosorbent assays (ELISA) for quantitative assessment . Fluorescently labeled SSP1183 can be used in confocal microscopy studies to visualize localization during host cell interaction.

For functional characterization, develop cellular models that recapitulate relevant aspects of S. saprophyticus pathogenesis. Comparative survival assays using macrophage interaction models have been successfully employed to distinguish virulence capabilities between strains . The strain 9325, which exhibits enhanced survival during macrophage interaction compared to strains ATCC 15305 and 7108, could serve as a positive control in experiments assessing SSP1183's contribution to immune evasion. Additionally, transcriptomic analysis of host cells following exposure to purified SSP1183 can identify altered gene expression patterns that suggest specific cellular pathways affected by the protein.

How can proteomic approaches enhance our understanding of UPF0365 protein SSP1183 function?

Proteomic approaches offer powerful tools for elucidating SSP1183 function within the broader context of S. saprophyticus biology. Comparative proteomics of different S. saprophyticus strains has already revealed significant differences in protein expression profiles that correlate with phenotypic variations in virulence and persistence capabilities . To specifically investigate SSP1183, targeted proteomic approaches can be implemented, including:

  • Quantitative proteomics to measure expression levels across different growth conditions, revealing potential regulatory mechanisms and environmental triggers

  • Protein-protein interaction studies using proximity-labeling approaches or co-immunoprecipitation coupled with mass spectrometry to identify functional interaction networks

  • Post-translational modification analysis to characterize how modifications may regulate SSP1183 activity

  • Structural proteomics combining crystallography or cryo-electron microscopy with computational modeling to predict functional domains

The methodology should incorporate rigorous controls and statistical analyses to ensure reproducibility and reliability. As observed in proteomic studies of S. saprophyticus strains, the majority of peptides should be detected with an error of less than 10 ppm, and analyses should achieve at least a 3-log range concentration with good distribution of high and low molecular weights .

How can I address solubility issues when working with recombinant UPF0365 protein SSP1183?

Addressing solubility challenges with SSP1183 requires strategic approaches that account for the protein's hydrophobic domains. Based on the amino acid sequence (MIGLIIIVVIVLVALLLLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVISPLIKAHKAGLHLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSTIG), the N-terminal region contains highly hydrophobic residues consistent with a membrane-associated domain . To improve solubility:

  • Modify expression constructs to remove highly hydrophobic regions while retaining functional domains

  • Utilize solubility-enhancing fusion partners such as SUMO, MBP, or thioredoxin

  • Optimize expression conditions including temperature (often lower temperatures improve folding), inducer concentration, and expression duration

  • Implement co-expression with molecular chaperones to assist proper folding

  • Explore detergent screening to identify optimal solubilization conditions

For extraction and purification, incorporate appropriate detergents or amphipathic agents that maintain protein solubility without compromising structure or function. A systematic detergent screening approach evaluating different classes (non-ionic, zwitterionic, and mild ionic detergents) can identify optimal conditions. Additionally, consider nanodiscs or liposome reconstitution for functional studies of membrane-associated domains, which provide a more native-like environment than detergent solubilization alone.

What approaches can overcome experimental variability in SSP1183 functional assays?

Controlling experimental variability is critical for obtaining reliable and reproducible results in SSP1183 functional assays. Research on methodological quality in intervention trials has identified common deficiencies that should be addressed, including inadequate blinding, insufficient power analyses, and failure to systematically assess adverse events . To overcome these limitations when working with SSP1183:

  • Implement rigorous experimental design with clearly defined independent and dependent variables, appropriate controls, and sufficient biological and technical replicates

  • Utilize blinded data collection where the investigator analyzing results is unaware of sample identity to prevent unconscious bias

  • Conduct power analyses prior to experiments to determine appropriate sample sizes needed to detect biologically meaningful effects

  • Standardize protocols for protein preparation, storage, and handling to minimize batch-to-batch variability

  • Include internal controls in each experiment to normalize results and account for day-to-day variations

Additionally, consider the inherent proteomic flexibility observed among S. saprophyticus strains . This biological variability necessitates careful selection of reference strains and thorough characterization of experimental systems. When comparing results across different studies or laboratories, standardize reporting using consistent units of measurement and statistical approaches to facilitate meta-analysis and data integration.

How should I analyze proteomic data related to UPF0365 protein SSP1183 expression across different S. saprophyticus strains?

Analysis of proteomic data related to SSP1183 expression across different S. saprophyticus strains requires rigorous statistical and bioinformatic approaches. Based on established methodologies in comparative proteomics studies of S. saprophyticus, implement a workflow that includes:

  • Quality control of raw data, ensuring peptide parts per million errors (ppm) are predominantly below 10 ppm (>75% of detected peptides), similar to the quality metrics achieved in previous S. saprophyticus proteomics studies

  • Normalization of protein abundance data to account for technical variation between samples

  • Statistical analysis to identify significantly regulated proteins, utilizing appropriate tests based on data distribution (e.g., ANOVA with post-hoc tests for multiple strain comparisons)

  • Functional enrichment analysis to contextualize SSP1183 regulation within broader biological processes

When interpreting results, consider the broader proteomic context observed in different S. saprophyticus strains. Previous studies have identified strain-specific differences in virulence-associated proteins that correlate with phenotypic characteristics such as macrophage survival and biofilm formation . Integration of SSP1183 expression data with these established patterns can provide insights into its potential functional role. Additionally, comparison with non-regulated proteins (e.g., those involved in transcription, translation, glycolysis, and amino acid metabolism that show consistent expression across strains) can help identify whether SSP1183 is constitutively expressed or condition-dependent.

What bioinformatic approaches can predict UPF0365 protein SSP1183 function and interactions?

Bioinformatic approaches offer valuable tools for predicting SSP1183 function and interactions when experimental data is limited. A comprehensive bioinformatic analysis should include:

  • Sequence homology searches to identify related proteins with known functions across bacterial species

  • Structural prediction using tools like AlphaFold or I-TASSER to generate 3D models that can inform functional hypotheses

  • Domain analysis to identify conserved functional motifs that might suggest molecular activities

  • Protein-protein interaction prediction using co-expression data, genomic context, and structural docking simulations

  • Subcellular localization prediction based on signal peptides and transmembrane domain analysis

Integrating these predictions with experimental data from related proteins in the S. saprophyticus proteome can provide context for generating testable hypotheses. For instance, the known associations between thioredoxin systems and oxidative stress response in S. saprophyticus could inform investigations if SSP1183 contains domains suggesting redox activity. Similarly, if SSP1183 contains structural similarities to known urease accessory proteins, this might suggest involvement in the urease system, which varies significantly between S. saprophyticus strains and influences virulence capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.