Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132 (SSP2132)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132 (SSP2132) is a protein expressed by the bacterium Staphylococcus saprophyticus subsp. saprophyticus . S. saprophyticus is a Gram-positive bacterium and a common cause of community-acquired urinary tract infections (UTI) . SSP2132 is also referred to as UPF0382 membrane protein SSP2132, with UPF0382 standing for "Unknown Protein Function" .

Basic Information

FeatureDescription
Product CodeCSB-CF673252SBAG
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C
Uniprot No.Q49VD3
Product TypeTransmembrane Protein
Immunogen SpeciesStaphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
SequenceMKVFIILGALNAMMAVGTGAFGAHGLENKLSAKYLSVWEKATTYQMYHGLGLLAIGIISGTTSINVNWVGWLLFFGIVFFSGSLYILALTQIRIIGAITPIGGVLFIVGWLMLVIGTFKI
SourceIn vitro E. coli expression system
Target NamesSSP2132
Protein NamesUPF0382 membrane protein SSP2132
Expression Region1-120
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C

Structure and Function

SSP2132 is a membrane protein, as suggested by its name, and is anchored in the cell wall . The structure of proteins, including SSP2132, is determined by the sequence of DNA, which dictates the sequence of amino acids . The primary structure refers to the sequence of amino acids, while the secondary structure arises from interactions of the peptide backbone, such as alpha-helices .

Proteins like SSP2132 perform essential functions, such as controlling the flow of materials in and out of cells, cell division, and metabolism . A related protein in S. saprophyticus, SssF, contributes to resistance against the antibacterial effects of linoleic acid .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your process.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SSP2132; UPF0382 membrane protein SSP2132
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
SSP2132
Target Protein Sequence
MKVFIILGALNAMMAVGTGAFGAHGLENKLSAKYLSVWEKATTYQMYHGLGLLAIGIISG TTSINVNWVGWLLFFGIVFFSGSLYILALTQIRIIGAITPIGGVLFIVGWLMLVIGTFKI
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP2132

STRING: 342451.SSP2132

Protein Families
UPF0382 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SSP2132 and what is its role in Staphylococcus saprophyticus?

SSP2132 is an UPF0382 family membrane protein found in Staphylococcus saprophyticus subsp. saprophyticus strain ATCC 15305 / DSM 20229. It is a relatively small membrane protein with 120 amino acids that likely plays a role in the membrane biology of this uropathogenic bacterium. While the precise function remains under investigation, its classification as a membrane protein suggests involvement in cellular processes such as transport, signaling, or maintaining membrane integrity. S. saprophyticus is a significant uropathogen, responsible for approximately 10-15% of uncomplicated urinary tract infections (UTIs) in young women . The membrane proteins of this organism, including SSP2132, may contribute to its pathogenicity and survival in the urinary tract environment.

How should researchers store and handle recombinant SSP2132 preparations?

Recombinant SSP2132 should be stored in Tris-based buffer with 50% glycerol. For long-term storage, maintain the protein at -20°C or -80°C to preserve activity and structural integrity . For working with the protein, prepare small aliquots to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of function. Working aliquots can be stored at 4°C for up to one week .

When handling the protein:

  • Use sterile techniques to prevent contamination

  • Work at appropriate temperatures (typically 4°C) to minimize degradation

  • Add protease inhibitors when necessary

  • Consider adding reducing agents if the protein contains disulfide bonds

  • Document all freeze-thaw cycles for experimental reproducibility

What expression systems are recommended for producing recombinant SSP2132?

For membrane proteins like SSP2132, several expression systems can be considered:

Expression SystemAdvantagesLimitationsRecommended For
E. coliCost-effective, rapid growth, high yieldsMay not properly fold complex membrane proteinsInitial screening, structural studies requiring high yield
Yeast (P. pastoris, S. cerevisiae)Eukaryotic folding machinery, post-translational modificationsLonger expression time, more complex mediaProteins requiring specific folding environments
Insect cellsAdvanced folding machinery, good for toxic proteinsHigher cost, specialized equipmentProteins that fail in simpler systems
Cell-free systemsAvoids toxicity issues, allows direct incorporation of detergentsLower yields, higher costDifficult-to-express proteins, rapid screening

For SSP2132, an E. coli-based expression system with specialized tags for membrane protein expression (such as a His-tag combined with a solubility enhancer like MBP or SUMO) would be a reasonable starting point. The expression should be optimized with reduced temperature (16-25°C) to enhance proper folding.

What analytical methods are suitable for basic characterization of purified SSP2132?

Analytical MethodInformation ProvidedSample Requirements
SDS-PAGEPurity, apparent molecular weight1-10 μg protein
Western blotIdentity confirmation, expression level10-100 ng protein
Mass spectrometryExact mass, post-translational modifications1-100 pmol protein
Circular dichroismSecondary structure content0.1-1 mg/ml, in CD-compatible buffer
Dynamic light scatteringHomogeneity, aggregation state0.5-2 mg/ml, filtered sample
ELISAQuantitative detection, antigenicityVariable, typically ng-μg range

For membrane proteins like SSP2132, additional techniques should be considered:

  • Detergent screening for optimal solubilization

  • Fluorescence-based thermal stability assays

  • Native gel electrophoresis to assess oligomeric state

What structural biology techniques are most effective for studying SSP2132?

For membrane proteins like SSP2132, several complementary structural biology approaches should be considered:

TechniqueResolutionAdvantagesLimitationsApplication to SSP2132
X-ray crystallographyAtomic (1-3Å)High resolution, well-establishedRequires crystals, often needs protein engineeringChallenging for small membrane proteins, may require fusion partners
NMR spectroscopyAtomic (2-5Å)Solution state, dynamics informationSize limitations, requires isotope labelingWell-suited for SSP2132's 120 aa size, requires optimization in membrane mimetics
Cryo-EMNear-atomic (2-4Å)No crystals needed, works for large complexesHistorically limited for small proteins, though improvingMay require larger assemblies or scaffold approaches
Lipid nanodiscsN/A (environment)Native-like lipid environmentRequires optimizationExcellent for studying SSP2132 in membrame context

NMR spectroscopy using lipid nanodiscs (6-26 nm in diameter) would be particularly valuable for studying SSP2132 in a native-like environment . This approach allows for the investigation of structure, dynamics, and potentially protein-protein or protein-lipid interactions. The development of circularized membrane scaffold proteins (MSPs) has improved the size homogeneity and stability of these nanoparticles, making them ideal for structural studies of membrane proteins like SSP2132 .

How might SSP2132 contribute to S. saprophyticus pathogenicity in urinary tract infections?

While the specific role of SSP2132 in pathogenicity has not been directly established in the literature, we can make informed hypotheses based on known properties of membrane proteins and S. saprophyticus virulence mechanisms:

  • Potential Involvement in Adhesion: Some membrane proteins contribute to bacterial adhesion to host tissues. Although major adhesins like UafA are already characterized in S. saprophyticus , SSP2132 might play an accessory role in this process.

  • Stress Response and Environmental Adaptation: Membrane proteins often help bacteria adapt to changing environmental conditions. SSP2132 might contribute to S. saprophyticus' ability to survive in the urinary tract, which presents challenges including osmotic stress, pH fluctuations, and nutrient limitations.

  • Transport Functions: If SSP2132 functions as a transporter, it might facilitate uptake of nutrients essential for growth in the urinary tract or export of compounds that contribute to pathogenicity.

  • Immune Evasion: Some bacterial membrane proteins help pathogens evade host immune responses. S. saprophyticus strain ATCC 15305 produces a capsular polysaccharide that provides resistance to complement-mediated opsonophagocytic killing by human neutrophils . If SSP2132 plays a role in capsule production or modification, it could contribute to immune evasion.

Future experimental approaches to test these hypotheses should include:

  • Generating knockout mutants lacking SSP2132

  • Evaluating phenotypic changes in adhesion, colonization, and persistence in animal models

  • Assessing survival under various stress conditions

What approaches can be used to study SSP2132 in a native lipid environment?

Studying membrane proteins like SSP2132 in a native lipid environment is crucial for understanding their true structure and function. Several methodological approaches are recommended:

  • Lipid Nanodiscs: These consist of a patch of lipid bilayer encircled by membrane scaffold proteins (MSPs) . They provide a native-like environment while maintaining compatibility with solution-state techniques.

    Implementation strategy:

    • Select appropriate nanodisc size (6-26 nm diameter options available)

    • Use circularized MSPs for better size homogeneity and stability

    • Optimize protein-to-nanodisc ratio to ensure proper incorporation

    • Apply a robust assay to determine the number of SSP2132 proteins per nanodisc

  • NMR Spectroscopy with Lipid Nanodiscs: This combination allows high-resolution structural determination of membrane proteins in their native environment .

    Key considerations:

    • Isotope labeling of SSP2132 (15N, 13C)

    • Selection of appropriate lipid composition mimicking S. saprophyticus membrane

    • Optimization of sample conditions (temperature, pH, buffer)

    • Application of appropriate NMR pulse sequences for membrane proteins

  • Electron Microscopy: When combined with nanodiscs or other membrane mimetics, EM can provide structural insights.

  • Native Mass Spectrometry: Emerging techniques allow for analysis of membrane proteins with some lipids still attached, providing insights into protein-lipid interactions.

What experimental challenges are associated with structural studies of SSP2132?

Structural characterization of membrane proteins like SSP2132 presents several significant challenges that researchers should anticipate and address:

  • Expression and Purification Obstacles:

    • Low expression yields compared to soluble proteins

    • Potential toxicity to expression hosts

    • Requirement for detergents or lipid environments throughout purification

    • Risk of protein aggregation or misfolding during expression

  • Structural Determination Challenges:

    • Difficulties in obtaining diffraction-quality crystals for X-ray crystallography

    • Signal broadening in NMR due to slower tumbling in membrane mimetics

    • Size limitations for certain structural techniques

    • Maintaining protein stability in non-native environments

  • Functional Assessment Limitations:

    • Difficulties in establishing reliable functional assays for proteins of unknown function

    • Potential loss of function when removed from native membrane environment

    • Challenges in reconstituting protein in functional form

  • Protein-Specific Considerations for SSP2132:

    • Small size (120 amino acids) may complicate certain structural approaches

    • Hydrophobic nature increases purification challenges

    • Unknown binding partners or cofactors may be essential for structure or function

Mitigation strategies should include:

  • Screening multiple expression systems, detergents, and buffer conditions

  • Using fusion tags to enhance solubility and expression

  • Employing native-like membrane mimetics such as nanodiscs

  • Considering a hybrid approach using multiple complementary structural techniques

How can mutagenesis approaches be applied to study SSP2132 function?

Strategic mutagenesis can provide valuable insights into the structure-function relationship of SSP2132:

Mutagenesis ApproachPurposeDesign ConsiderationsExpected Outcomes
Alanine scanningIdentify functionally important residuesSystematically replace residues with alanineIdentify residues essential for function
Truncation mutantsDetermine minimal functional domainCreate progressively shorter versionsMap functional domains/regions
Cysteine mutagenesisEnable site-specific labelingReplace non-conserved residues with cysteineAllow for fluorescent labeling, crosslinking studies
Conserved motif targetingDisrupt predicted functional regionsIdentify conserved motifs across homologsConfirm importance of evolutionary conserved elements
Charge reversalProbe electrostatic interactionsReplace charged residues with opposite chargeIdentify charge-dependent interactions

When designing a mutagenesis study for SSP2132:

  • Begin with bioinformatic analysis to identify conserved residues and potential functional motifs

  • Focus initially on predicted transmembrane domains and loops

  • Include both conservative and non-conservative substitutions

  • Create a clear functional readout system to assess mutant phenotypes

  • Consider the effect of mutations on protein stability and expression

What is the recommended protocol for solubilizing and purifying SSP2132?

A systematic approach to solubilization and purification is essential for obtaining functional SSP2132:

Recommended Purification Protocol:

  • Cell Lysis and Membrane Preparation

    • Resuspend cells in buffer containing protease inhibitors

    • Disrupt cells using sonication or French press

    • Remove cell debris by low-speed centrifugation (10,000 × g, 20 min)

    • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membrane fraction to remove peripheral proteins

  • Detergent Screening and Solubilization

    • Screen multiple detergents at varying concentrations:

      • Mild detergents: DDM, LMNG, digitonin

      • Moderate detergents: DM, OG, CHAPS

      • Harsh detergents: SDS, Triton X-100 (for complete solubilization)

    • Solubilize membranes for 1-2 hours at 4°C with gentle agitation

    • Remove insoluble material by ultracentrifugation

  • Affinity Purification

    • Apply solubilized material to appropriate affinity resin

    • Wash extensively to remove non-specifically bound proteins

    • Elute using competitive elution or tag cleavage

    • Consider on-column detergent exchange if necessary

  • Size Exclusion Chromatography

    • Further purify by size exclusion chromatography

    • Monitor protein homogeneity and oligomeric state

    • Collect fractions containing monodisperse protein

  • Quality Control

    • Assess purity by SDS-PAGE

    • Verify identity by mass spectrometry or Western blotting

    • Evaluate protein stability using thermofluor assays

    • Determine concentration using appropriate methods for membrane proteins

How can researchers set up a functional assay for SSP2132?

Establishing functional assays for membrane proteins of unknown function requires a systematic approach:

  • Bioinformatic Prediction-Based Assays

    • Analyze sequence for functional domains or motifs

    • Identify close homologs with known functions

    • Design assays based on predicted functions:

      • Transport activity (if predicted transporter)

      • Binding assays (if predicted receptor)

      • Enzymatic activity (if predicted enzyme)

  • General Membrane Protein Function Assays

    • Liposome reconstitution to test for:

      • Ion conductance

      • Small molecule transport

      • Membrane permeabilization

    • Protein-protein interaction studies:

      • Pull-down assays with potential partners

      • Bacterial two-hybrid systems

      • Crosslinking approaches

  • Phenotypic Assays in S. saprophyticus

    • Generate knockout or overexpression strains

    • Assess changes in:

      • Growth under various conditions

      • Biofilm formation

      • Stress tolerance

      • Antibiotic susceptibility

      • Virulence in infection models

  • Data Collection and Analysis Guidelines

    • Ensure appropriate controls for each assay

    • Perform experiments in triplicate at minimum

    • Establish dose-response relationships where applicable

    • Use statistical analysis to determine significance of findings

    • Validate key findings using complementary approaches

What approaches can be used to identify potential interaction partners of SSP2132?

Identifying interaction partners can provide crucial insights into SSP2132 function:

ApproachMethodologyAdvantagesLimitations
Co-immunoprecipitationPull-down using anti-SSP2132 antibodiesCan identify native interactionsRequires specific antibodies, may miss transient interactions
Crosslinking-MSChemical crosslinking followed by MS analysisCaptures transient interactionsComplex data analysis, potential false positives
Bacterial two-hybridGenetic screen for protein interactionsIn vivo detectionMay not work for membrane proteins
Proximity labelingBioID or APEX2 fusion proteinsIdentifies proteins in close proximityRequires genetic modification
Genetic suppressor screensIdentify mutations that suppress SSP2132 mutant phenotypesFunctional relevanceLabor intensive, requires clear phenotype

Implementation strategy:

  • Begin with in silico prediction of interaction partners based on genomic context and co-expression data

  • Perform pull-down experiments using tagged SSP2132 in native membrane extracts

  • Confirm key interactions using orthogonal methods

  • Characterize the functional significance of verified interactions

How might SSP2132 be exploited in developing novel antimicrobial strategies?

Membrane proteins like SSP2132 represent potential targets for antimicrobial development, particularly if they prove essential for bacterial survival or virulence:

  • Target Validation Approaches:

    • Determine essentiality of SSP2132 in S. saprophyticus

    • Assess contribution to virulence in animal models

    • Evaluate conservation across related staphylococcal species

    • Examine structural uniqueness compared to human proteins

  • Therapeutic Development Strategies:

    • Structure-based drug design targeting SSP2132 specific pockets

    • High-throughput screening for inhibitors of SSP2132 function

    • Antibody-based approaches if portions are surface-exposed

    • Peptide inhibitors designed to disrupt critical interactions

  • Potential Advantages as a Drug Target:

    • Location in cell membrane makes it potentially accessible

    • Specificity to S. saprophyticus could limit collateral damage to commensal flora

    • Novel target may circumvent existing resistance mechanisms

  • Research Required Before Therapeutic Development:

    • Complete structural characterization

    • Establishment of robust functional assays

    • Determination of physiological relevance

    • Assessment of essentiality under various conditions

What role might SSP2132 play in S. saprophyticus adaptation to the urinary tract environment?

Understanding the potential role of SSP2132 in adaptation to the urinary tract requires consideration of the unique challenges of this environment:

  • Environmental Adaptation Hypotheses:

    • Osmotic stress response: The urinary tract presents significant osmotic challenges that membrane proteins may help manage

    • pH adaptation: Urine pH varies considerably, and membrane proteins often contribute to pH homeostasis

    • Nutrient acquisition: Limited nutrients in urine may require specialized transport systems

    • Immune evasion: S. saprophyticus must evade host defenses, potentially through capsule production

  • Experimental Approaches to Test These Hypotheses:

    • Compare expression levels of SSP2132 under conditions mimicking the urinary tract versus standard laboratory conditions

    • Assess the impact of SSP2132 deletion on survival in artificial urine medium

    • Evaluate changes in membrane properties in response to urinary tract stressors

    • Examine interactions with host components such as antimicrobial peptides

  • Comparative Approaches:

    • Analyze SSP2132 conservation across uropathogenic vs. non-uropathogenic staphylococci

    • Examine evolutionary adaptations in the protein sequence that might confer urinary tract-specific advantages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.