Recombinant Staphylococcus sp. Quaternary ammonium compound-resistance protein qacC (qacC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus sp. Quaternary Ammonium Compound-Resistance Protein qacC

The Recombinant Staphylococcus sp. Quaternary ammonium compound-resistance protein qacC, often referred to as qacC, is a protein encoded by the qacC gene. This gene is responsible for conferring resistance to quaternary ammonium compounds (QACs), which are commonly used as disinfectants and biocides. The qacC protein belongs to the Small Multidrug Resistance (SMR) family of proteins, which are known for their role in exporting toxic compounds from bacterial cells .

Structure and Function of qacC Protein

The qacC protein is a small membrane protein, typically around 100 amino acids in length, and contains two transmembrane domains. It is believed to form dimers in the bacterial membrane, creating a pore that facilitates the efflux of quaternary ammonium compounds from the cell . The protein's structure includes a sole cysteine residue at position 42, which plays a crucial role in substrate recognition and resistance specificity .

Expression and Production of Recombinant qacC

Recombinant qacC protein is produced by expressing the qacC gene in a host organism, such as Escherichia coli. The recombinant protein is often fused with a His-tag for easy purification and is available in a lyophilized form with a purity of over 90% . The recombinant qacC protein is used in research to study its function and mechanism of action in detail.

Mechanism of Resistance

The qacC protein confers resistance to quaternary ammonium compounds through a proton-dependent export mechanism. This means that the protein uses the proton gradient across the bacterial membrane to drive the efflux of toxic compounds . The specific amino acid residues, such as Tyr-59 and Trp-62, are essential for the structural and functional integrity of the protein .

Gene Mobility and Spread

The qacC gene is often found on small rolling-circle plasmids, which are capable of replicating independently of the bacterial chromosome. The gene's location between the Double Strand replication Origin (DSO) and the Single Strand replication Origin (SSO) allows for its mobilization and transfer to other plasmids without the need for additional genetic elements . This mechanism has contributed to the widespread dissemination of the qacC gene among Staphylococcus species.

Research Findings and Implications

Recent studies have highlighted the rapid spread of the qacC gene among Staphylococcus aureus isolates, contributing to increased resistance against quaternary ammonium compounds . This has significant implications for public health, as it may reduce the effectiveness of commonly used disinfectants in clinical settings.

Table 2: Amino Acid Sequence of Recombinant qacC

Sequence
MPYIYLIISISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQHLPLNITYA TWAGLGLVLTTVVSIIIFKEQINLITIVSIVLIIVGVVSLNIFGTSH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
qacC; Quaternary ammonium compound-resistance protein QacC; Quaternary ammonium determinant C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Staphylococcus sp. (strain ST827)
Target Names
qacC
Target Protein Sequence
MPYIYLIISISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQHLPLNITYA TWAGLGLVLTTVVSIIIFKEQINLITIVSIVLIIVGVVSLNIFGTSH
Uniprot No.

Target Background

Function

Multidrug exporter implicated in resistance to bacteriocidal quaternary ammonium compounds.

Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the qacC gene and what is its primary function in Staphylococcus species?

The qacC gene encodes a protein that provides resistance to quaternary ammonium compounds (QACs) in Staphylococcus species, particularly Staphylococcus aureus. This gene belongs to the Small Multidrug Resistant (SMR) protein family and is primarily responsible for efflux-mediated resistance to biocides and disinfectants commonly used in healthcare settings. The gene products are typically around 100 amino acids long and contain two trans-membrane domains that form dimers in the bacterial cell membrane, creating pores through which the QAC substrates are extruded from the cell .

How does qacC differ from other quaternary ammonium compound resistance genes found in Staphylococcus species?

Four distinct classes of SMR-type qac gene families have been identified in Staphylococcus species: qacC, qacG, qacJ, and qacH. While these genes share the broad function of conferring resistance to quaternary ammonium compounds, qacC displays an extraordinary level of sequence conservation compared to the others. Within their respective classes, these genes are highly conserved, but qacC genes are extremely conserved despite being distributed across variable plasmid backgrounds with lower degrees of sequence identity . This pattern suggests that qacC has undergone recent mobilization and spread among staphylococcal populations, utilizing a unique mechanism of gene transfer that distinguishes it from other qac gene variants.

What methodological approaches are most effective for detecting and characterizing qacC genes in clinical isolates?

When investigating qacC genes in clinical isolates, researchers should implement a multi-faceted approach:

  • PCR-based detection: Design primers targeting the highly conserved regions of qacC. Due to the extreme conservation of qacC sequences, PCR assays can be highly sensitive and specific.

  • Whole genome sequencing: For comprehensive characterization, sequence the entire plasmid carrying qacC to understand its genetic context.

  • Phenotypic resistance testing: Perform minimum inhibitory concentration (MIC) assays using various quaternary ammonium compounds to confirm functional expression.

  • Plasmid isolation and characterization: Since qacC genes are typically found on small rolling-circle replicating plasmids, plasmid isolation followed by restriction enzyme analysis can provide insights into the plasmid background.

  • Comparative sequence analysis: Compare isolated qacC sequences with reference databases to identify conservation patterns and potential evolutionary relationships .

This combined approach enables comprehensive characterization of qacC genes and their genetic contexts, which is essential for understanding their spread in bacterial populations.

How can quasi-experimental designs be applied to study the dissemination of qacC genes in healthcare environments?

Quasi-experimental designs are particularly valuable for studying qacC gene dissemination in healthcare settings where true randomized experiments are ethically or practically impossible . A methodological approach might include:

  • Nonequivalent groups design: Compare healthcare facilities with different quaternary ammonium compound usage policies, investigating the prevalence of qacC-carrying Staphylococcus isolates in each. While facilities cannot be randomly assigned to different disinfection protocols, researchers can select similar facilities and control for confounding variables in their analysis .

  • Time series analysis: Monitor qacC prevalence before and after changes in disinfection protocols within a single healthcare facility to assess temporal trends.

  • Natural experiments: Take advantage of unplanned changes in disinfection practices (e.g., supply chain issues forcing temporary changes in disinfectant use) to study the effects on qacC prevalence .

  • Regression discontinuity design: If a threshold-based policy exists for implementing enhanced disinfection protocols (perhaps based on infection rates), compare units just above and below the threshold to assess effects on qacC prevalence .

These quasi-experimental approaches allow researchers to study qacC spread in real-world settings while maintaining methodological rigor.

What is the proposed mechanism for qacC gene mobilization between rolling-circle plasmids, and how does this differ from conventional gene mobility mechanisms?

The qacC gene employs a unique mobilization mechanism that differs significantly from conventional mechanisms requiring transposable elements or recombination machinery. Based on sequence analyses of plasmids carrying qacC, researchers have proposed a model where:

  • The qacC gene is strategically positioned between the Double Strand replication Origin (DSO) and the Single-Strand replication Origin (SSO) on rolling-circle (RC) replicating plasmids .

  • This specific arrangement creates a transferable element (DSO-qacC-SSO) that can be mobilized as a unit without requiring assistance from other genes .

  • During rolling-circle replication, this element may be excised and subsequently integrated into recipient plasmids, explaining the extreme conservation of qacC despite variable plasmid backgrounds .

This mechanism represents a novel mode of gene mobility in RC-plasmids that has not been widely documented before. The model explains how resistance genes can spread efficiently without the energy cost of maintaining complex mobile genetic elements. Other resistance genes, such as lnuA (conferring lincomycin resistance), appear to utilize similar positional advantages for mobilization .

How can evolutionary analyses of qacC sequences inform our understanding of antimicrobial resistance gene dissemination in bacterial populations?

Evolutionary analyses of qacC sequences provide critical insights into resistance gene dissemination through several methodological approaches:

  • Molecular clock analyses: By comparing the degree of sequence divergence between qacC genes and their plasmid backgrounds, researchers can estimate the timing of recent mobilization events. The striking conservation of qacC despite variable plasmid contexts suggests very recent spread .

  • Phylogenetic comparisons: Constructing phylogenetic trees of qacC genes and their host plasmids reveals incongruencies that highlight horizontal gene transfer events. These analyses can identify donor-recipient relationships among plasmids.

  • Selection pressure mapping: Identifying which regions of qacC show purifying selection versus neutral evolution helps understand which functional domains are essential for resistance.

  • Comparative genomics with related resistance genes: Analyzing the evolutionary relationships between qacC and other SMR-family genes (qacG, qacH, qacJ) provides context for understanding specialization and adaptation processes .

These evolutionary approaches allow researchers to reconstruct the spread of resistance determinants and predict future dissemination patterns, informing surveillance and intervention strategies for antimicrobial resistance management.

What experimental designs are most appropriate for evaluating cross-resistance between quaternary ammonium compounds and clinical antibiotics in qacC-positive strains?

When investigating potential cross-resistance between quaternary ammonium compounds and clinical antibiotics in qacC-positive strains, researchers should consider these methodological approaches:

  • Comprehensive MIC determination: Systematically determine minimum inhibitory concentrations for multiple classes of antibiotics using standardized methods such as broth microdilution or agar dilution in isogenic strains with and without qacC.

  • Gene expression analysis: Quantify expression of qacC and other efflux systems following exposure to subinhibitory concentrations of various antimicrobials to detect potential co-regulation.

Experimental DesignAdvantagesLimitationsData Analysis Method
Case-control comparisonControls for strain backgroundCannot establish causalityStudent's t-test, ANOVA
Isogenic complementationDirect assessment of qacC impactMay not reflect natural settingsPaired statistical tests
Growth curve analysisDynamic resistance assessmentLabor intensiveTime-series analysis, area under curve
Competition assaysMeasures fitness costsComplex interactionsCompetitive index calculation
  • Time-kill assays: Expose qacC-positive and qacC-negative strains to combinations of QACs and antibiotics at varying concentrations to identify potential synergistic or antagonistic effects.

  • Mutant construction and complementation: Create isogenic mutants by deleting qacC and complementing with plasmid-borne qacC to definitively demonstrate the role of qacC in any observed cross-resistance.

  • Transcriptomic analysis: Perform RNA-seq to identify genes differentially expressed in the presence of qacC that might contribute to broader resistance phenotypes.

These methodological approaches provide rigorous evidence for establishing any clinical relevance of qacC-mediated resistance beyond its primary substrate specificity.

How might researchers apply People Also Ask data to develop more comprehensive research directions on antimicrobial resistance genes like qacC?

Researchers can leverage Google's People Also Ask (PAA) data as a valuable resource for understanding knowledge gaps and research priorities related to antimicrobial resistance genes like qacC. A methodological approach includes:

  • Systematic query analysis: Conduct structured searches around qacC-related terms and document all PAA questions that appear, analyzing them for patterns and common themes .

  • Temporal tracking: Monitor how PAA questions change over time to identify emerging concerns or shifts in research focus. PAA data often reflects current research trends and emerging concepts .

  • Comparative analysis: Compare PAA questions across different geographical regions to identify regional priorities in antimicrobial resistance research.

  • Intent classification: Categorize PAA questions by research intent (basic science, clinical application, public health, etc.) to map the distribution of knowledge queries .

  • Literature gap analysis: Cross-reference PAA questions with published literature to identify questions frequently asked but inadequately addressed in current research.

This systematic approach to analyzing PAA data can help researchers identify underexplored aspects of qacC biology and prioritize research directions that address actual knowledge gaps rather than already well-studied areas, ultimately leading to more impactful antimicrobial resistance research.

What are the most effective methods for presenting complex data on qacC gene transfer and resistance profiles in scientific publications?

When presenting complex data on qacC gene transfer and resistance profiles, researchers should consider these methodological approaches:

  • Structured data tables: Present comparative data in well-organized tables rather than lists, ensuring consistency in formatting and clear labeling of all variables . For example:

Plasmid BackgroundqacC Sequence VariationMIC Range for QACs (μg/ml)Co-occurring Resistance Genes
pSK108100% conservation8-16blaZ, ermC
pST827100% conservation4-16tetK
pNVH01100% conservation8-32None
  • Visualization techniques: Utilize appropriate graphical representations for different data types:

    • Sequence conservation: multiple sequence alignments with highlighting

    • Plasmid relationships: circular plasmid maps with annotated features

    • Resistance profiles: heat maps showing MIC values across strains and compounds

  • Statistical analysis presentation: Include appropriate statistical measures when presenting comparability of data, such as:

    • Measures of variability (standard deviations, confidence intervals)

    • Statistical significance indicators

    • Effect size calculations where appropriate

  • Methodological transparency: Clearly document all experimental conditions, controls, and replication to ensure reproducibility and proper interpretation of results.

By following these approaches, researchers can ensure that complex data on qacC is presented in a manner that facilitates accurate interpretation and meaningful comparison with other studies in the field.

How can researchers distinguish between correlation and causation when analyzing associations between qacC presence and disinfectant resistance phenotypes?

Distinguishing between correlation and causation when analyzing qacC-disinfectant resistance associations requires rigorous methodological approaches:

  • Quasi-experimental designs: Since true randomized experiments may be ethically challenging with clinical isolates, quasi-experimental designs offer valuable alternatives:

    • Nonequivalent groups design: Compare naturally occurring qacC-positive and qacC-negative isolates while controlling for other resistance determinants

    • Natural experiments: Analyze isolates before and after exposure to disinfectants

    • Regression discontinuity: Examine isolates with varying levels of qacC expression against resistance thresholds

  • Molecular genetic manipulation:

    • Gene deletion: Create isogenic mutants lacking qacC

    • Complementation: Restore qacC in deletion mutants

    • Heterologous expression: Express qacC in naturally qacC-negative species

    • Site-directed mutagenesis: Create point mutations in functional domains

  • Advanced statistical approaches:

    • Multiple regression: Control for confounding variables

    • Propensity score matching: Match qacC-positive and negative isolates on other characteristics

    • Mediation analysis: Identify intermediate factors in the causal pathway

  • Dose-response relationships: Demonstrate that increasing qacC expression correlates with proportional increases in resistance, supporting causality.

By implementing these methodological approaches, researchers can move beyond simple correlations to establish causal relationships between qacC presence and resistance phenotypes, providing more meaningful contributions to our understanding of antimicrobial resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.