Recombinant Staurastrum punctulatum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-319
Protein Length
Full Length of Mature Protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
petA
Target Protein Sequence
FPIYAQQNYESPREATGRIVCANCHLAKKAVDIEVPQAVLPDTVFEAVVKIPYDTQIKQV LSNGKKGGLNVGAVLILPEGFELAPSDRIPPELKEKISNIYFQPYSPEKKNILVVGPLPG NKYSELVFPILSPDPATNKKASFLKYPIYLGGNRGRGQVYPDGSKSNNNVFSASTAGTIS QITRQKKGGYEVIIKTTDGREVTDIIPPGPELIVSEGESIKADQLLTNNPNVGGFGQADA EIVLQDPLRIQGLLVFFASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Recombinant Staurastrum punctulatum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How do disulfide-reducing pathways affect the assembly of recombinant Apocytochrome f?

    Disulfide reduction is a critical step in the assembly of functional cytochrome f. Recent research has revealed that multiple pathways are involved in controlling the redox status of heme-binding cysteines in apocytochrome f.

    Studies have identified that "TWO DISULFIDE-REDUCING PATHWAYS ARE REQUIRED FOR CYTOCHROME C ASSEMBLY" . These pathways include components such as CCS4 and CCS5, with CCS5 containing a redox-active WCXXC motif capable of reducing disulfide bonds between heme-linking cysteines.

    When designing experiments with recombinant apocytochrome f, researchers should consider:

    • The redox environment during protein expression and purification

    • Inclusion of appropriate thiol-reducing agents during protein handling

    • Verification of cysteine redox state before heme reconstitution experiments

    Evidence shows that "In vitro, a recombinant form of CCS5 containing the WCXXC motif is redox-active and able to reduce a disulfide bond formed between the heme-linking cysteines of a soluble form of apocytochrome f" . The cytochrome assembly defect in mutants lacking these pathways can be chemically corrected by exogenously applied reducing agents, demonstrating the physiological relevance of these disulfide reductase activities.

    For recombinant expression systems, researchers should methodically evaluate whether the host organism provides adequate disulfide reduction machinery or if supplementation with reducing agents is necessary.

  • What are the implications of using different expression systems for producing recombinant Apocytochrome f?

    The choice of expression system significantly impacts the structural integrity, post-translational modifications, and functionality of recombinant Apocytochrome f. Based on available data, researchers have several options with distinct advantages and limitations.

    Expression SystemAdvantagesLimitationsSpecial Considerations
    E. coliHigh yield, simple cultivationLimited post-translational modificationsUsed successfully for truncated versions
    YeastSome eukaryotic modificationsNot native to chloroplast environmentAvailable as product CSB-YP653511SCAK1
    BaculovirusComplex protein foldingMore costly, longer production timeAvailable as product CSB-BP653511SCAK1
    Mammalian cellsMost complex modificationsHighest cost, lowest yieldAvailable as product CSB-MP653511SCAK1

    When selecting an expression system, researchers should consider:

    1. Whether heme incorporation is required (may need specialized systems)

    2. If membrane integration is necessary for the study

    3. The importance of native-like folding and modifications

    From the literature, we see that "A 741-bp fragment of the cytochrome f gene (petA) from broad bean corresponding to the globular N-terminal domain of the mature protein was expressed in E. coli" . This approach focuses on the soluble domain and avoids the challenges of membrane protein expression.

    For studying the full-length protein including its transmembrane domain, researchers should methodically evaluate whether eukaryotic expression systems provide better results despite their higher cost and complexity.

  • How can researchers investigate interactions between recombinant Apocytochrome f and plastid-lipid structures?

    Investigating interactions between recombinant Apocytochrome f and plastid-lipid structures requires specialized methodological approaches that simulate the native membrane environment.

    Research has shown that "M_r catabolites of cytochrome f detectable in isolated plastoglobuli and stromal lipid-protein particles are native components of the particles and are not simply free polypeptides" . This association with lipid structures is physiologically relevant and worth investigating in recombinant systems.

    Methodological approaches should include:

    1. Lipid reconstitution assays:

      • Incorporate recombinant protein into liposomes of defined composition

      • Measure protein-lipid interactions using fluorescence resonance energy transfer (FRET)

      • Analyze protein orientation using protease protection assays

    2. Co-sedimentation experiments:

      • Mix recombinant protein with isolated thylakoid membranes or synthetic lipid vesicles

      • Fractionate by centrifugation to assess binding

      • Analyze bound fractions by immunoblotting

    3. Size-exclusion chromatography:

      • Examine co-elution patterns with lipid particles

      • Compare profiles with native cytochrome f preparations

    Evidence indicates that "the cytochrome f catabolites co-elute with lipid, which indicates that they are eluting as elements of lipid particles rather than as free polypeptides" . Researchers should use similar analytical techniques when working with recombinant proteins to verify proper lipid interactions.

Experimental Design Questions

  • How should experiments be designed to compare the function of recombinant versus native Apocytochrome f?

    Designing rigorous comparative studies between recombinant and native Apocytochrome f requires careful planning to account for structural and functional differences while ensuring fair comparisons.

    Key experimental considerations:

    1. Protein preparation standardization:

      • Match protein concentrations precisely using quantitative assays

      • Ensure similar buffer conditions for both proteins

      • Consider the impact of tags on recombinant proteins

    2. Structural comparison workflow:

      • Begin with spectroscopic methods (CD, fluorescence)

      • Progress to more detailed structural analyses (if available)

      • Assess thermal stability under identical conditions

    3. Functional assay design:

      • Heme incorporation efficiency comparison

      • Electron transfer capability measurements

      • Interaction with physiological partners

    Control experiments should include:

    • Positive controls using well-characterized cytochrome f preparations

    • Negative controls using denatured protein samples

    • Internal standards for normalization between experiments

    Research has shown that "the cytochrome f catabolites were only detectable in a subset of the lipid-protein particles eluted from the size-exclusion column. This indicates that they are not simply free polypeptides adhering to the surface of the particles as contaminants" . This observation highlights the importance of characterizing the physical state of both recombinant and native proteins before functional comparisons.

    A comprehensive experimental design should include parallel assays under identical conditions, with multiple replicates and appropriate statistical analysis to account for batch-to-batch variations in both recombinant and native protein preparations.

  • What experimental approaches can effectively study the role of disulfide bonds in recombinant Apocytochrome f assembly?

    Investigating the role of disulfide bonds in Apocytochrome f assembly requires targeted experimental approaches that can selectively manipulate and monitor the redox state of specific cysteine residues.

    Methodological framework:

    1. Site-directed mutagenesis strategies:

      • Replace key cysteine residues with serine or alanine

      • Create single and double mutants to assess individual contributions

      • Example: "We first substituted the two cysteinyl residues responsible for covalent ligation of the c-heme, by a valine and a leucine, and showed that heme binding is not a prerequisite for cytochrome f processing"

    2. Redox manipulation experiments:

      • Express protein under varying redox conditions

      • Add reducing agents at different stages of purification

      • Test reconstitution under oxidizing vs. reducing environments

    3. Analytical techniques for disulfide bond assessment:

      • Non-reducing vs. reducing SDS-PAGE to visualize disulfide-linked species

      • Mass spectrometry to map disulfide connectivity

      • Labeling of free thiols with specific reagents

    Case study design:
    Research has demonstrated that "pre-apocytochrome f adopts a suitable conformation for the cysteinyl residues to be substrates of the heme lyase and pre-holocytochrome f folds in an assembly-competent conformation" . Experiments can be designed to test whether recombinant systems faithfully replicate this process:

    1. Express the protein with intact or mutated cysteine residues

    2. Monitor folding using structural probes

    3. Assess heme incorporation efficiency

    4. Evaluate assembly into functional complexes

    The observed phenomenon that "the cytochrome assembly defect in mutants lacking these pathways can be chemically corrected by exogenously applied reducing agents" suggests that redox manipulation is a powerful approach for studying these processes in recombinant systems.

  • How can researchers design experiments to investigate the interaction between recombinant Apocytochrome f and other components of the photosynthetic electron transport chain?

    Investigating interactions between recombinant Apocytochrome f and other components of the photosynthetic electron transport chain requires specialized experimental approaches that can detect both physical associations and functional coupling.

    Interaction analysis strategy:

    1. Physical interaction studies:

      • Co-immunoprecipitation with antibodies against recombinant Apocytochrome f

      • Pull-down assays using tagged recombinant protein

      • Surface plasmon resonance to measure binding kinetics

      • Chemical cross-linking followed by mass spectrometry (XL-MS)

    2. Functional coupling assessment:

      • Reconstitution of partial electron transport chains

      • Measurement of electron transfer rates between components

      • Inhibitor studies to verify specificity of interactions

    3. Structural investigation of complexes:

      • Cryo-electron microscopy of reconstituted complexes

      • Single-particle analysis to determine complex architecture

      • Molecular modeling based on interaction data

    Experimental controls should include:

    • Non-interacting proteins as negative controls

    • Known interaction partners as positive controls

    • Competition assays with excess unlabeled components

    When designing these experiments, researchers should note that "Full-length versions of thylakoid photosynthetic proteins have been detected previously in stromal lipid-protein particles and are thought to be denatured proteins that are no longer functional and, accordingly, have been voided from the membrane bilayer" . This suggests the importance of verifying the functional state of recombinant proteins before interaction studies.

    A systematic approach would start with binary interactions between recombinant Apocytochrome f and individual components, gradually building to more complex assemblies that better reflect the native environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.