Recombinant Staurastrum punctulatum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Production and Applications

Recombinant cemA is produced via bacterial expression systems (e.g., E. coli) and purified to >85% purity . Key production parameters include:

ParameterDetail
Storage BufferTris-based buffer + 50% glycerol
Storage Conditions-20°C/-80°C (avoid freeze-thaw)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Applications:

  • Research: Used in studies of chloroplast membrane dynamics, transport mechanisms, and stress responses.

  • Biotechnology: Potential utility in engineering photosynthetic efficiency or stress resilience in algae .

Research Findings and Context

  • Chloroplast Envelope Proteomics: Proteomic studies in Arabidopsis identified envelope transporters with α-helical TM domains, a feature shared by cemA . These proteins often have high isoelectric points (pI > 8.8) and low residue-to-TM ratios, indicative of inner membrane localization .

  • Evolutionary Conserved Roles: While Staurastrum cpDNA lacks an rRNA inverted repeat, its genome retains conserved envelope proteins, aligning with land plant chloroplast evolution .

Challenges and Future Directions

  • Functional Validation: Direct evidence of cemA’s role in proton extrusion or carbon uptake remains pending experimental confirmation.

  • Comparative Studies: Phylogenetic analysis with cemA homologs (e.g., Oenothera argillicola, Manihot esculenta) could elucidate conserved mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
cemA
Target Protein Sequence
MLMKAHDSKFYRWLFSTPYRALHRAYEASKKVRNIQRDYLFYKNAVGDSSKRSFYNVTLY IDSILNQSASNIFWSLLEFKISINLCNFIVSLRDPHIDNEKSDFIFESFNKSTKENLENL VDLQKDKNLLSNERKNVISLNSYTRSFKQKIGNYINLLIGWKPKNEVNYLTENLSFTSSI EENCFFLKKFYNKTLDWERWNRKLTWIEAVLIDLELLKNKGWFSSEALSEQRNPQPFPNF NTSYKTVSLSGPFVERSKKMQKIGSRSKLNQNFSPYIDPGAGTYGSTTKEGSSGANSRKG NPFGRSVRGTEKVKDTAYESLGLVPRSITRTLSRFQTELAGRSASLVLPEFRLAKYQAIT SIKYLAFLIFCPWLVLTVCKILFLEPLIENWWNTAQFQIFLSFSQEEKALKRLQQVEELL WLDIIMADSSAKQPQDLSAQIHQRTIDLVETYNQESIQTILHFFTNFLFIFVVISLLIWG KKRLAILNSWVQEVFYSLSDTMKAFFILLFTDLCIGFHSPHGWEILIGFILEHLGFSHNK HVISCFVSTFPVILDTVFKYWIFRHLNRISPSIVVSYHTMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended expression systems for producing recombinant cemA protein?

E. coli expression systems are most commonly used for recombinant production of cemA protein. The protein is typically expressed with an N-terminal His-tag to facilitate purification . When working with the recombinant protein:

  • Expression vector selection: Plasmid vectors such as pBR322 have been used successfully for cloning cemA, with marker genes to facilitate selection .

  • Expression conditions: The full-length protein (1-582 amino acids for S. punctulatum) should be expressed in E. coli under conditions that minimize inclusion body formation.

  • Purification approach: His-tagged cemA can be purified using immobilized metal affinity chromatography (IMAC).

  • Quality control: SDS-PAGE analysis should confirm purity greater than 90% .

The recombinant protein is typically supplied as a lyophilized powder or in a Tris/PBS-based buffer with 50% glycerol at pH 8.0 .

How does cemA vary across different photosynthetic organisms?

cemA displays significant sequence variability across different photosynthetic lineages while maintaining its presence in most chloroplast genomes. Comparative chloroplast genome analyses reveal:

  • Conservation status: cemA is considered one of the conserved genes in streptophyte chloroplast genomes, included in the set of 88 protein-coding genes used for phylogenetic analyses .

  • Length variations: The protein length varies between species - in Oryza sativa, cemA consists of 230 amino acids , while in Staurastrum punctulatum, it spans 582 amino acids .

  • Evolutionary patterns: Table 1 from the comparative chloroplast genome study illustrates the presence of cemA across various streptophyte taxa:

TaxonGenome Size (bp)G+C (%)Gene Count% Coding
Mesostigma viride118,36030.113773.2
Staurastrum punctulatum157,08932.512258.4
Cosmarium botrytis207,85039.812247.9
Zygnema circumcarinatum165,37231.112557.8

Note: cemA is included among the counted genes for each species listed above

  • Codon usage and G+C content: The G+C content varies significantly among different species, potentially affecting codon optimization strategies for recombinant expression. Staurastrum punctulatum has a moderate G+C content of 32.5% .

What are the optimal conditions for storage and handling recombinant cemA?

For optimal stability and activity of recombinant S. punctulatum cemA protein:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Long-term storage: Store at -20°C/-80°C, with -80°C preferred for extended storage .

  • Buffer composition: The protein is most stable in Tris-based buffer with 50% glycerol at pH 8.0 .

  • Avoiding degradation:

    • Centrifuge vials briefly before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for freezing

    • Prepare small aliquots to avoid repeated freeze-thaw cycles

  • Stability concerns: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of function .

What are the primary experimental applications for recombinant cemA protein?

Recombinant S. punctulatum cemA can be utilized in various experimental applications:

  • Structural studies: The protein can be used for structural characterization using techniques such as X-ray crystallography or NMR to determine membrane topology and functional domains.

  • Protein-protein interaction studies: Identifying interaction partners within the chloroplast envelope membrane complex.

  • Functional assays: Reconstitution into liposomes for functional studies of membrane transport properties.

  • Antibody production: Generation of specific antibodies for immunolocalization studies in algal cells.

  • SDS-PAGE analysis: The recombinant protein can serve as a standard for electrophoretic studies .

When designing experiments with recombinant cemA, researchers should consider the hydrophobic nature of this membrane protein and optimize experimental conditions accordingly.

What regulatory guidelines apply to research involving recombinant cemA?

Research involving recombinant cemA is subject to biosafety regulations, particularly when using genetic engineering techniques:

  • NIH Guidelines: Research involving recombinant or synthetic nucleic acid molecules, including those used for cemA expression, must comply with NIH Guidelines that specify biosafety practices and containment principles .

  • Institutional approvals: Experiments should be reviewed and approved by your institution's Biosafety Committee (IBC) .

  • Compliance requirements: For NIH-funded research, compliance with the NIH Guidelines is mandatory regardless of the source of funding for the specific recombinant DNA experiment .

  • International considerations: Research conducted abroad must comply with both host country regulations and applicable U.S. guidelines .

The regulations specify that:

"As a condition for NIH funding of recombinant or synthetic nucleic acid molecule research, institutions shall ensure that such research conducted at or sponsored by the institution, irrespective of the source of funding, shall comply with the NIH Guidelines."

How can cemA be utilized in phylogenetic studies of algal evolution?

The cemA gene has proven valuable for phylogenetic analysis of photosynthetic organisms:

  • Multiple sequence alignment: Align cemA sequences from diverse algal species using MUSCLE or MAFFT algorithms to identify conserved domains and variable regions.

  • Phylogenetic reconstruction: cemA can be included in multi-gene datasets for more robust phylogenetic analyses. In previous studies, cemA was included among 88 protein-coding genes used for constructing phylogenetic trees of streptophyte algae .

  • Evolutionary rate assessment: Calculate d𝑁, d𝑆, and d𝑁/d𝑆 ratios to determine selective pressures on cemA, similar to analyses performed for other chloroplast genes like tufA .

  • Topology comparison: The phylogenetic trees derived from cemA can be compared with those from other chloroplast genes to evaluate congruence.

  • Data interpretation: The study of streptophyte algae using chloroplast genes including cemA has revealed that Zygnematophyceae are sister to land plants, with specific branching patterns within the group .

What bioinformatic tools and approaches are recommended for analyzing cemA?

Several bioinformatic approaches can be employed for comprehensive analysis of cemA:

  • Transmembrane domain prediction: Use TMHMM, Phobius, or CCTOP to predict membrane-spanning regions within the cemA protein sequence.

  • Subcellular localization prediction: Tools like TargetP and PredAlgo can confirm chloroplast targeting, though as noted in the literature, PredAlgo was found superior for predicting chloroplast localization in Chlorophyceae and Trebouxiophyceae .

  • Homology modeling: Generate structural models using AlphaFold2 or SWISS-MODEL based on related membrane proteins.

  • Codon optimization: For recombinant expression, codon optimization tools should account for the G+C content of the source organism (32.5% for S. punctulatum) versus the expression host .

  • Genome structure analysis: Tools like REPuter can be used to identify repeat elements in the genomic region containing cemA, as done in the comparative genomic analysis where repeat content was quantified across different species .

What experimental designs are most effective for studying cemA function?

To investigate the functional roles of cemA in chloroplast biology:

  • Gene knockout/knockdown strategies:

    • CRISPR-Cas9 targeting of cemA in model algal species

    • RNA interference to reduce cemA expression

    • Analysis of resulting phenotypes with focus on photosynthetic efficiency and CO₂ uptake

  • Protein localization:

    • Immunogold electron microscopy using antibodies against recombinant cemA

    • Fluorescent protein fusions to visualize subcellular localization

  • Interaction studies:

    • Co-immunoprecipitation using tagged recombinant cemA

    • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

    • Proximity labeling approaches such as BioID

  • Functional reconstitution:

    • Reconstitution of purified recombinant cemA into liposomes

    • Assessment of membrane transport properties

    • Electrophysiological measurements of reconstituted membranes

  • Comparative approaches:

    • Complementation studies using cemA from different species to identify conserved functional domains

When designing such experiments, researchers should include appropriate controls and consider the complex membrane environment where cemA naturally functions.

What are the main technical challenges when working with recombinant cemA and how can they be addressed?

Working with recombinant cemA presents several technical challenges:

  • Membrane protein solubility:

    • Challenge: cemA is a hydrophobic membrane protein that may aggregate during expression and purification

    • Solution: Optimize detergent selection (mild non-ionic detergents like DDM or LMNG) for solubilization and purification

  • Protein folding in heterologous systems:

    • Challenge: Ensuring proper folding in E. coli expression systems

    • Solution: Consider expression at lower temperatures (16-18°C) and use of specialized E. coli strains (e.g., C41/C43 or Rosetta)

  • Optimization of purification:

    • Challenge: Achieving high purity while maintaining function

    • Solution: Implement two-step purification strategy combining IMAC with size exclusion chromatography

  • Functional assessment:

    • Challenge: Determining if recombinant protein retains native function

    • Solution: Develop in vitro functional assays after reconstitution into liposomes

  • Long-term stability:

    • Challenge: Maintaining stability during storage

    • Solution: Follow recommended storage conditions with 50% glycerol at -80°C and avoid repeated freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.