Recombinant Staurastrum punctulatum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
petD
Target Protein Sequence
MGVIKKPDLTDPVLRAKLAKGMGHHYYGEPAWPNDLLYMFPVCILGTIACNVGLAVLEPS LIGEPANPFATPLEILPEWYFFPVFQILRVVPNKLLGVLLMASVPVGLITVPFIENVNKF QNPFRRPVATTIFLIGTVVAVWLGIGATLPIDTSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What functional role does the Cytochrome b6-f Complex Subunit 4 (petD) play in photosynthetic processes?

The Cytochrome b6-f Complex Subunit 4 (petD) serves as an essential component of the cytochrome b6-f complex, which functions as a critical intermediary in the photosynthetic electron transport chain. This complex, in conjunction with the Stt7 kinase, regulates the antenna sizes of photosystems I and II through state transitions . This regulatory mechanism allows photosynthetic organisms to optimize energy distribution between photosystems under varying light conditions, thereby maintaining photosynthetic efficiency across different environmental scenarios. Structurally, petD contributes to both the stability and functionality of the entire cytochrome b6-f complex assembly.

How do researchers distinguish between naturally occurring and recombinant forms of the protein?

Researchers distinguish between natural and recombinant forms through several methodological approaches:

  • Protein tagging analysis: The recombinant form typically contains an N-terminal His-tag that is absent in the natural form, detectable through western blotting with anti-His antibodies .

  • Expression system markers: Recombinant proteins expressed in E. coli may contain trace bacterial proteins or post-translational modification patterns distinct from the algal-derived natural protein .

  • Purity assessment: SDS-PAGE analysis reveals >90% purity in properly purified recombinant preparations, whereas natural preparations typically contain other cytochrome complex components .

  • Mass spectrometry validation: Precise molecular weight determination can identify the presence of expression tags and confirm sequence integrity relative to the natural protein.

What expression systems yield optimal results for recombinant petD production?

The optimal expression system documented for Recombinant Staurastrum punctulatum Cytochrome b6-f Complex Subunit 4 (petD) is Escherichia coli . This bacterial system offers several methodological advantages:

Table 1: E. coli Expression System Optimization Parameters

ParameterOptimal ConditionMethodological Consideration
Vector typepET-series with T7 promoterProvides high expression levels with IPTG induction
E. coli strainBL21(DE3) or derivativesReduces proteolytic degradation
Growth temperature16-18°C post-inductionMinimizes inclusion body formation
Induction0.1-0.5 mM IPTGLower concentrations favor soluble protein production
Growth mediaEnriched media (e.g., TB, 2xYT)Supports higher cell densities and protein yields

For researchers requiring membrane protein functionality, careful optimization of these parameters is essential as cytochrome complex proteins often present folding challenges in bacterial expression systems .

What purification strategy provides the highest yield and purity of functional recombinant petD protein?

A multi-step purification strategy is necessary to obtain high-purity, functional recombinant petD:

  • Initial capture: Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin to exploit the His-tag, with elution using an imidazole gradient (50-250 mM) .

  • Intermediate purification: Ion exchange chromatography to separate based on charge properties, particularly useful for removing E. coli contaminants with similar molecular weights.

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve >90% purity as determined by SDS-PAGE analysis .

Critical methodological considerations include maintaining appropriate buffer conditions (Tris/PBS-based buffer, pH 8.0) throughout purification and avoiding detergents that might disrupt protein structure unless membrane integration studies are planned .

How can researchers optimize storage conditions to maintain protein stability and activity?

Optimal storage conditions to preserve recombinant petD stability and activity include:

Table 2: Storage Optimization Parameters

Storage ParameterRecommendationScientific Rationale
Physical stateLyophilized powder for long-term; solution for working stocksReduced molecular mobility in lyophilized state limits degradation
Temperature-20°C/-80°C for long-term; 4°C for up to one week (working solutions)Lower temperatures slow degradation processes
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Trehalose acts as a stabilizing agent protecting protein structure
CryoprotectantAddition of 5-50% glycerol for solution storagePrevents ice crystal formation that can denature proteins
AliquotingSmall single-use aliquotsAvoids repeated freeze-thaw cycles that promote denaturation
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLMaintains proper protein folding during rehydration

Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, highlighting the importance of proper aliquoting practices .

How can recombinant petD be utilized to study the assembly mechanism of the cytochrome b6-f complex?

Recombinant petD offers valuable tools for investigating cytochrome b6-f complex assembly through several methodological approaches:

  • Complementation studies: Introducing recombinant petD into deletion mutants (ΔpetD) to assess restoration of complex assembly and function. Research shows that petD deletion results in dramatically reduced cytochrome f synthesis and accumulation, suggesting petD plays a critical role in complex stability .

  • Protein-protein interaction analysis: Using tagged recombinant petD in pull-down assays to identify assembly factors and chaperones that facilitate complex formation.

  • Temporal assembly mapping: Pulse-chase experiments with recombinant petD to determine the sequence and kinetics of subunit incorporation during complex assembly.

  • Structural domain analysis: Comparing the assembly competence of recombinant petD variants with mutations or truncations in specific domains to identify regions critical for complex formation.

Research indicates that subunit IV (petD) has a significantly higher rate of protein turnover in mutants lacking proper complex assembly, suggesting quality control mechanisms monitor assembly status .

What experimental design best demonstrates the role of petD in state transitions?

An optimal experimental design to investigate petD's role in state transitions would include:

  • Mutagenesis approach: Target the stromal region of petD using site-directed or random mutagenesis, particularly focusing on the region from the PEWY motif to the C-terminal end, encompassing helices F and G .

  • Transformation methodology: Introduce these petD variants into the chloroplast genome of a ΔpetD host strain using chloroplast transformation techniques .

  • Phenotypic analysis: Measure state transition kinetics using:

    • Chlorophyll fluorescence (77K) to determine PSI/PSII excitation energy distribution

    • Phosphorylation analysis of LHCII proteins using phospho-specific antibodies

    • Confocal microscopy with fluorescently labeled LHCII to track movement between photosystems

  • Biochemical confirmation: Assess interaction between modified petD and the Stt7 kinase through co-immunoprecipitation or FRET analysis.

Research has established that the cytochrome b6-f complex works with the Stt7 kinase to regulate photosystem antenna sizes through state transitions, making petD modifications particularly informative for understanding this regulatory mechanism .

How can petD sequence analysis across species contribute to understanding photosynthetic evolution?

Phylogenetic analysis of petD sequences provides valuable insights into photosynthetic evolution:

  • Comparative genomic framework: Alignment of petD sequences from diverse photosynthetic organisms, with special focus on charophyte green algae like Staurastrum punctulatum, which represent important evolutionary positions as sister groups to land plants .

  • Structure-function conservation assessment: Identification of:

    • Highly conserved domains (likely functionally critical)

    • Variable regions (potential adaptation signatures)

    • Lineage-specific modifications (environmental adaptations)

  • Evolutionary rate analysis: Calculation of synonymous vs. non-synonymous substitution rates to identify regions under selection pressure.

  • Genomic context evaluation: Analysis of gene arrangement surrounding petD in chloroplast genomes across diverse photosynthetic lineages.

Research by Qiu et al. (2006) demonstrated that phylogenetic analysis of six chloroplast genes confirmed charophytes as the sister group to land plants, underscoring the evolutionary significance of studying genes like petD in these lineages .

Which regions of the petD protein are most critical for cytochrome b6-f complex function?

Structure-function studies have identified several critical regions in petD:

Table 3: Critical Functional Regions in petD

RegionLocationFunctional SignificanceResearch Methodology
PEWY motifConserved sequence motifEssential for electron transportSite-directed mutagenesis
Helix ETransmembrane domainCore structural element buried in complexStructural analysis
Helices F and GC-terminal regionTarget for random mutagenesis studiesError-prone PCR mutagenesis
Stromal regionSurface-exposed domainInvolved in regulatory interactionsRandom mutagenesis screening

Experimental approaches demonstrate that the region extending from the PEWY motif to the C-terminal end (comprising helices F and G) is particularly amenable to mutagenesis studies, while helix E remains relatively inaccessible due to its position buried in the complex core .

What high-throughput mutagenesis approaches are most effective for studying petD structure-function relationships?

The most effective high-throughput mutagenesis strategy for petD involves:

  • Random mutagenesis via error-prone PCR: This approach has been successfully applied to the petD region from the PEWY motif to the C-terminal end, encompassing helices F and G .

  • Chloroplast transformation delivery: The plasmid library containing randomly mutagenized petD fragments can be used to transform the chloroplast genome of a ΔpetD host strain .

  • Sequencing validation: Comprehensive sequencing of both E. coli libraries and Chlamydomonas reinhardtii transformants confirms mutational diversity and absence of sequence heterogeneity in the transformed algae .

  • Functional screening: Phenotypic analysis of transformants for:

    • Photosynthetic electron transport rates

    • State transition capability

    • Growth under varying light conditions

    • Cytochrome b6-f complex assembly and stability

Research demonstrates that this combined approach yields mutants with varied functional properties, providing insights into structure-function relationships without requiring prior structural knowledge .

How do stromal region mutations in petD affect interactions with regulatory proteins?

Mutations in the stromal region of petD affect regulatory protein interactions through several mechanisms:

  • Altered binding interfaces: Modifications to surface-exposed residues can directly impact the physical interaction surfaces between petD and regulatory proteins such as the Stt7 kinase.

  • Conformational changes: Mutations may induce structural alterations that propagate through the protein, affecting distant interaction sites or altering the presentation of binding epitopes.

  • Assembly defects: Some mutations impact the integration of petD into the complete cytochrome b6-f complex, indirectly affecting interactions with regulatory proteins that require the assembled complex.

  • Stability effects: Mutations can affect protein stability, altering the half-life of petD and consequently the duration of potential regulatory interactions.

Research indicates that in petD deletion mutants, the rate of synthesis of cytochrome f is strongly decreased, suggesting complex assembly defects that would impact regulatory interactions . The stromal region has been specifically implicated in important functional interactions, though detailed mapping of regulatory protein binding sites requires further investigation.

How has the petD gene evolved across the green algal lineage leading to land plants?

The evolution of petD across the green algal lineage reveals important adaptive patterns:

  • Conserved chloroplast location: The petD gene has maintained its position in the chloroplast genome throughout the evolution of green algae and land plants, reflecting its critical function in photosynthesis .

  • Sequence conservation patterns: Comparative analysis reveals:

    • Highly conserved functional domains (transmembrane regions, catalytic sites)

    • Variable regions that may reflect adaptation to different light environments

    • Lineage-specific modifications correlating with major evolutionary transitions

  • Genomic context changes: While petD location in the chloroplast genome is conserved, the arrangement of surrounding genes shows evolutionary plasticity, providing insights into chloroplast genome restructuring during plant evolution.

  • Intron acquisition/loss patterns: Comparison of petD gene structures across lineages can reveal patterns of intron gain or loss, which represent important evolutionary signatures.

Research on charophyte chloroplast genomes, including analysis of genes like petD, has helped establish that Charophyceae represent the sister group to land plants, highlighting the evolutionary significance of these algal lineages .

What biochemical adaptations in petD are associated with the transition from aquatic to terrestrial environments?

The transition from aquatic to terrestrial environments likely required several biochemical adaptations in petD:

  • Stress response elements: Terrestrial environments expose photosynthetic machinery to more extreme temperature and light fluctuations, potentially driving adaptations in regulatory domains of petD.

  • Interaction interface modifications: Changes in the stromal region may reflect adaptations in regulatory protein interactions that evolved to handle terrestrial conditions.

  • Structural stability enhancements: Amino acid substitutions that increase protein stability under more variable terrestrial conditions compared to the relatively stable aquatic environment.

  • Regulatory coupling adjustments: Modifications in regions involved in state transitions or cyclic electron flow, which are important for handling fluctuating light conditions typical in terrestrial environments.

Comparative genomic studies of charophyte algae like Staurastrum punctulatum provide crucial insights into these adaptations, as these organisms represent the evolutionary lineage that gave rise to land plants . Phylogenetic analysis of genes including petD supports the position of Charophyceae as the sister group to land plants, making them ideal for studying adaptations associated with terrestrialization.

What methodological approaches best integrate structural, functional, and evolutionary data about petD?

An integrated methodological framework for petD research should combine:

  • Structural biology techniques:

    • X-ray crystallography or cryo-EM of petD in the context of the cytochrome b6-f complex

    • Molecular dynamics simulations to predict structural effects of mutations

    • Homology modeling based on structures from diverse species

  • Functional characterization:

    • Complementation studies using recombinant petD variants in deletion backgrounds

    • Electron transport measurements to assess functional effects of mutations

    • State transition assays to evaluate regulatory impacts

  • Evolutionary analysis:

    • Phylogenetic reconstruction using petD sequences from diverse photosynthetic organisms

    • Selection pressure analysis to identify positively selected residues

    • Ancestral sequence reconstruction to test hypotheses about evolutionary adaptations

  • Integrative data analysis:

    • Mapping evolutionary conservation onto structural models

    • Correlating functional effects of mutations with structural positions and evolutionary conservation

    • Integrating transcriptomic and proteomic data to understand regulatory networks

This integrated approach allows researchers to connect structural features with functional significance and evolutionary history, providing a comprehensive understanding of how petD has evolved to maintain and adapt its critical role in photosynthesis across diverse lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.