Recombinant Staurastrum punctulatum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Background

Cytochrome b6 (petB) is a transmembrane protein encoded by the chloroplast petB gene. In S. punctulatum, this gene is part of the conserved psbB operon but notably lacks introns, simplifying its cloning and recombinant expression . The recombinant form is produced in Escherichia coli with a His-tag for purification .

Functional Role in Photosynthesis

As part of the cytochrome b₆f complex, petB facilitates:

  • Electron Transport: Mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) .

  • Proton Gradient Generation: Supports ATP synthesis via the Q-cycle mechanism .
    S. punctulatum’s petB exhibits evolutionary divergence, lacking introns present in vascular plants, which may enhance translational efficiency .

Protocol Overview:

  1. Cloning: The petB gene (intron-free in S. punctulatum) is inserted into an E. coli expression vector .

  2. Expression: Induced under optimized conditions for soluble protein yield .

  3. Purification: Affinity chromatography via His-tag, followed by buffer exchange into Tris/glycerol formulations .

Critical Notes:

  • Avoid repeated freeze-thaw cycles; aliquot for short-term use at 4°C .

  • Lyophilized forms require reconstitution in deionized water or Tris/PBS buffers .

Table 2: Primary Applications of Recombinant petB

ApplicationUse Case
ELISA DevelopmentAntigen production for antibody validation
Structural StudiesCrystallography or NMR to resolve cytochrome b₆f complex architecture
Functional AssaysIn vitro reconstitution of electron transport chains
Comparative GenomicsEvolutionary analysis of chloroplast gene clusters across algae and plants

Evolutionary and Comparative Insights

  • Gene Cluster Conservation: The psbB operon in S. punctulatum mirrors land plants but lacks introns in petB and petD, suggesting recent evolutionary divergence .

  • Cyanobacterial Homologs: Shares 60–70% sequence identity with Prochlorothrix hollandica petB (UniProt P28058), underscoring functional conservation .

Limitations and Future Directions

  • Functional Complexity: Requires assembly with other subunits (e.g., PetD, PetG) for full activity .

  • Structural Dynamics: Conformational changes during electron transport remain poorly resolved, necessitating cryo-EM studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing it during production.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDVTNKYVPPHVNIFYCLGGIVFTSFIIQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLVRSVHRWSASMMVMTMILHIFRVYLTGGFKKPRELTWVT GVILSVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGAPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVVMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also participates in cyclic electron flow around PSI and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its function in Staurastrum punctulatum?

Cytochrome b6, encoded by the petB gene, is a crucial component of the cytochrome b6-f complex in the photosynthetic electron transport chain of Staurastrum punctulatum. This protein facilitates electron transfer between photosystem II and photosystem I, contributing to the generation of proton gradients necessary for ATP synthesis. In Staurastrum punctulatum, a green alga belonging to the Desmidiaceae family within the Zygnematales order, the cytochrome b6 protein plays a significant role in the unique chloroplast characteristics that evolved during the diversification of charophycean green algae . The chloroplast genome of Staurastrum punctulatum encodes 121 genes, with petB being one of the conserved genes essential for photosynthetic function .

What are the challenges in expressing recombinant Cytochrome b6 from Staurastrum punctulatum?

Expressing recombinant membrane proteins like Cytochrome b6 presents several challenges. The hydrophobic nature of transmembrane regions can lead to protein aggregation and inclusion body formation during heterologous expression. Additionally, proper folding often requires specific lipid environments and cofactor incorporation (heme groups).

For Staurastrum punctulatum Cytochrome b6 specifically, researchers may encounter challenges related to codon optimization when expressing in common systems like E. coli, given the evolutionary distance between cyanobacteria/algae and bacteria. The expression protocol might need adjustment compared to other recombinant proteins, potentially requiring specialized expression systems that better accommodate membrane proteins. Based on related protein expression systems, strategies may include using specialized E. coli strains, optimizing growth temperatures (typically lowered to 16-25°C during induction), and employing mild detergents for extraction .

What purification strategies yield the highest purity and activity for recombinant Staurastrum punctulatum Cytochrome b6?

A multi-step purification approach is typically required to obtain high-purity, active Cytochrome b6. Based on strategies for similar membrane proteins, an effective protocol might include:

  • Membrane isolation: Differential centrifugation following cell lysis

  • Solubilization: Using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Affinity chromatography: Utilizing N-terminal His-tag with Ni-NTA resin

  • Size exclusion chromatography: To remove aggregates and achieve final polishing

Table 1: Recommended purification buffers for recombinant Cytochrome b6

Purification StepBuffer CompositionNotes
Cell Lysis50 mM Tris-HCl (pH 8.0), 200 mM NaCl, 5% glycerol, protease inhibitorsKeep cold (4°C) throughout
Membrane SolubilizationLysis buffer + 1% DDM or 1% digitoninGentle stirring for 1-2 hours at 4°C
Ni-NTA Affinity50 mM Tris-HCl (pH 8.0), 200 mM NaCl, 0.05% DDM, 20-250 mM imidazole gradientMonitor elution spectrophotometrically
Size Exclusion20 mM Tris-HCl (pH 7.5), 100 mM NaCl, 0.03% DDMRun at low flow rate (0.3-0.5 ml/min)

The purified protein should be stored in buffer containing 50% glycerol at -20°C/-80°C for long-term storage, with avoidance of repeated freeze-thaw cycles .

How can researchers verify the proper folding and activity of recombinant Staurastrum punctulatum Cytochrome b6?

Verification of proper folding and activity of recombinant Cytochrome b6 requires multiple analytical approaches:

  • Spectroscopic analysis: UV-visible spectroscopy to verify characteristic absorption peaks of properly incorporated heme groups (typical peaks at approximately 414 nm (Soret band), 535 nm and 563 nm (α and β bands) in the reduced state)

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content, particularly the α-helical content expected in properly folded cytochrome b6

  • Functional assays: Electron transfer activity can be measured using artificial electron donors/acceptors such as decylplastoquinone and ferredoxin

  • Reconstitution experiments: Incorporation into liposomes to verify membrane insertion and function in a lipid bilayer environment

  • Thermal stability assays: Differential scanning calorimetry or fluorescence-based thermal shift assays to assess protein stability

SDS-PAGE analysis should show a band corresponding to the expected molecular weight of approximately 24-25 kDa, with Western blotting using anti-His antibodies to confirm identity if a His-tag was incorporated .

What techniques are most informative for structural characterization of recombinant Staurastrum punctulatum Cytochrome b6?

Multiple complementary techniques provide comprehensive structural insights into recombinant Cytochrome b6:

The combination of these techniques can generate a comprehensive structural model, revealing the transmembrane topology, cofactor binding sites, and potential interaction surfaces of Staurastrum punctulatum Cytochrome b6 .

How does the genomic context of the petB gene in Staurastrum punctulatum compare to other algal species?

The petB gene in Staurastrum punctulatum is encoded within its 157,089 bp chloroplast genome along with 120 other genes . Comparative genomic analysis reveals evolutionary insights into chloroplast genome organization across algal lineages.

The chloroplast genomes of Staurastrum punctulatum and other Zygnematales members have undergone extensive changes during evolution compared to other charophycean green algae. These changes include gene losses, rearrangements, and intron insertions. The specific genomic context of petB—including its neighboring genes, promoter elements, and potential operonic organization—provides clues about expression regulation and co-evolution with other photosynthetic components.

In many photosynthetic organisms, petB is often co-transcribed with petD (encoding subunit IV of the cytochrome b6-f complex), but genomic rearrangements in different lineages may alter this organization. The chloroplast genome of Staurastrum punctulatum represents an intermediate evolutionary stage between early-diverging charophycean green algae and land plants, making its gene organization particularly informative for understanding plastid genome evolution .

What post-translational modifications are observed in native Staurastrum punctulatum Cytochrome b6, and can these be reproduced in recombinant systems?

While specific data on post-translational modifications (PTMs) in Staurastrum punctulatum Cytochrome b6 is limited, cytochrome b6 proteins typically undergo several important modifications that are crucial for their function:

  • Heme attachment: The most critical modification is the covalent attachment of heme groups to specific cysteine or histidine residues, essential for electron transfer functionality.

  • Disulfide bond formation: Proper disulfide bonding contributes to structural stability.

  • Potential phosphorylation: Some cytochrome proteins are regulated by phosphorylation events.

Reproducing these modifications in recombinant systems presents challenges. E. coli expression systems may correctly incorporate heme groups if supplemented with δ-aminolevulinic acid, but may not reproduce all PTMs found in the native algal environment. Eukaryotic expression systems might provide more authentic PTM profiles but with lower yields.

Mass spectrometry analysis of both native (if available) and recombinant proteins can identify differences in modification patterns. For critical functional studies, researchers may need to consider whether the absence of specific modifications in recombinant systems impairs protein function, potentially necessitating alternative expression strategies or in vitro modification approaches.

How can researchers investigate the role of Staurastrum punctulatum Cytochrome b6 in photosynthetic electron transport chains?

Investigating the role of Staurastrum punctulatum Cytochrome b6 in photosynthetic electron transport requires sophisticated biochemical and biophysical approaches:

  • Reconstitution experiments: Incorporation of purified recombinant Cytochrome b6 into liposomes alongside other components of the electron transport chain allows for controlled study of electron transfer kinetics.

  • Flash photolysis: Time-resolved spectroscopy following light activation can measure electron transfer rates through the cytochrome b6-f complex.

  • Electrochemical analysis: Protein film voltammetry on electrode-immobilized cytochrome b6 can determine redox potentials and electron transfer characteristics.

  • Mutagenesis studies: Site-directed mutagenesis of conserved residues followed by functional assays can identify amino acids critical for activity.

  • Inhibitor binding studies: Analysis of binding kinetics with known cytochrome b6-f inhibitors like DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) provides insights into mechanism of action.

  • Interaction analysis: Techniques like isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can characterize interactions with electron donors/acceptors.

For comparative analysis, parallel studies with cytochrome b6 from other species can highlight unique features of the Staurastrum punctulatum protein in relation to its evolutionary context in the Zygnematales lineage .

What insights can evolutionary analysis of Staurastrum punctulatum Cytochrome b6 provide about photosynthetic adaptation?

Evolutionary analysis of Staurastrum punctulatum Cytochrome b6 offers valuable perspectives on photosynthetic adaptation across green algal lineages. The Zygnematales, to which Staurastrum punctulatum belongs, represent an important evolutionary position in the Streptophyta clade, with significant chloroplast genome changes compared to other charophycean green algae .

Phylogenetic analysis of petB sequences across green algae and land plants can reveal:

  • Patterns of sequence conservation in functional domains versus diversification in regulatory regions

  • Lineage-specific adaptations reflected in amino acid substitutions

  • Co-evolutionary patterns with interacting proteins in the electron transport chain

  • Selection pressures on different protein domains

These analyses can be correlated with environmental adaptations, as Staurastrum punctulatum inhabits freshwater environments that may impose specific constraints on photosynthetic efficiency. The cytochrome b6 protein's evolution may reflect adaptations to light conditions, temperature ranges, or other environmental factors specific to the ecological niches occupied by Staurastrum species .

Comparing the rates of synonymous versus non-synonymous substitutions in petB sequences can identify regions under positive selection, potentially highlighting functional innovations in the Zygnematales lineage that contributed to their ecological success.

What are the methodological considerations for investigating protein-protein interactions involving Staurastrum punctulatum Cytochrome b6?

Investigating protein-protein interactions involving Staurastrum punctulatum Cytochrome b6 requires specialized approaches suitable for membrane proteins:

  • Co-immunoprecipitation with antibodies against Cytochrome b6 or potential interaction partners, using carefully optimized detergent conditions to maintain interaction integrity while solubilizing membrane components.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry analysis can identify interaction interfaces while proteins remain in their native membrane environment.

  • Förster resonance energy transfer (FRET): Labeling Cytochrome b6 and potential interaction partners with appropriate fluorophores allows for detection of protein proximity in reconstituted systems.

  • Blue native PAGE: This technique preserves protein complexes during electrophoresis, allowing identification of stable complexes containing Cytochrome b6.

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): These techniques can measure binding kinetics between purified Cytochrome b6 and potential partners when one partner is immobilized on a sensor surface.

  • Yeast two-hybrid membrane system variants: Modified yeast two-hybrid systems designed for membrane proteins can screen for potential interaction partners.

A significant challenge in these studies is maintaining the native membrane environment or adequately mimicking it with appropriate detergents or lipid nanodisc systems. Researchers must carefully validate identified interactions using multiple complementary techniques to distinguish genuine biological interactions from artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.