Recombinant Staurastrum punctulatum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Staurastrum punctulatum NAD(P)H- Quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

The compound "Recombinant Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)" refers to a specific protein subunit within the NAD(P)H dehydrogenase (NDH) complex found in the chloroplasts of the green alga Staurastrum punctulatum . The NDH complex is crucial for various electron transport processes within the chloroplast, impacting photosynthesis and stress responses .

Staurastrum punctulatum

Staurastrum punctulatum is a species of green algae belonging to the Zygnematophyceae class . This algal species is commonly found in freshwater environments . The complete chloroplast DNA sequences of Staurastrum reveal how the chloroplast genome changed during evolution .

Experimental and Research Findings

4.1. Involvement in Plastoquinone Pool Redox State:

4.2. Interaction with Plastoquinones:

Plastoglobules purified functioned as a quinone-containing substrate and accepted electrons from NADPH and recombinant NDC1 enzyme in vitro . The plastoquinone pool was more oxidized in the ndc1 mutant than in the wild type .

4.3. Role in Vitamin K1 Production:

NDC1 is essential for vitamin K1 production .

Potential Applications

5.1. Drug Design:

NADH:quinone oxidoreductases are suitable targets for novel antimicrobial therapies, as these are the only enzymes with NADH:quinone oxidoreductase activity expressed in many pathogenic organisms .

Table: Key Features of Recombinant Staurastrum punctulatum NAD(P)H- Quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

FeatureDescription
Product NameRecombinant Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
SynonymsNAD(P)H-quinone oxidoreductase subunit H, chloroplastic; EC=1.6.5.-; NAD(P)H dehydrogenase subunit H; NADH-plastoquinone oxidoreductase 49 kDa subunit; NADH-plastoquinone oxidoreductase subunit H
Gene NamendhH
Source OrganismStaurastrum punctulatum
Expression HostE. coli, Yeast, Baculovirus, or Mammalian Cell
Purity>90%
FormLiquid containing glycerol
StorageStore at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
FunctionPart of the NDH complex, involved in electron transport from NAD(P)H to quinones; affects the redox state of the plastoquinone pool .
Role in Oxidative StressUpregulation of quinone reductases at the plasma membrane is a mechanism evoked by cells for defense against oxidative stress .
InhibitorsDicumarol inhibits some NAD(P)H:quinone oxidoreductases, but the enzyme with properties of cytochrome b5 reductase reduces coenzyme Q0 through a one-electron mechanism with the generation of superoxide and its inhibition profile by p-hydroxymercuribenzoate was similar to that of authentic cytochrome b5 reductase .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
ndhC
Target Protein Sequence
MPILPKYESFWAFLLIACLIPVLAISVSNLVAPSTSKNPEKSTTYESGIEPMGESWIQFQ IRYYMFALVFVIFDVETVFLYPWAMSFDDLGIIAFAEVLVFVIILIIGLIYAWRKGALEW S
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)?

Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplast-encoded protein that functions as a critical component of the NAD(P)H dehydrogenase (NDH) complex in the thylakoid membrane. This protein is part of the chloroplastic electron transport chain and contributes to cyclic electron flow around photosystem I. The recombinant version of this protein is produced through molecular cloning and heterologous expression systems, allowing researchers to study its properties outside its native context. Staurastrum punctulatum, a green alga belonging to the Desmidiaceae family, contains this protein as part of its photosynthetic machinery .

How does ndhC contribute to photosynthetic electron transport?

The ndhC subunit forms part of the membrane domain of the NDH complex, which facilitates electron transfer from NAD(P)H to plastoquinone. This process is crucial for:

  • Cyclic electron transport around Photosystem I

  • Chlororespiration (electron transport in darkness)

  • Optimizing the ATP/NADPH ratio for carbon fixation

  • Photoprotection under high light or stress conditions

The protein contains transmembrane helices that anchor it within the thylakoid membrane, where it participates in proton pumping across the membrane, contributing to the generation of proton motive force for ATP synthesis .

What distinguishes algal ndhC from higher plant homologs?

Algal ndhC proteins, including those from Staurastrum punctulatum, exhibit several key differences compared to their counterparts in higher plants:

FeatureStaurastrum punctulatum ndhCHigher Plant ndhC
Gene locationChloroplast genomeChloroplast genome
SizeTypically 120-130 amino acids120-125 amino acids
Transmembrane domainsUsually 3Usually 3
Sequence conservationHigher variability in loop regionsMore conserved sequences
Post-translational modificationsFewerMore extensive
Association with accessory proteinsSpecies-specific interactionsWell-characterized interactions

These differences reflect evolutionary adaptations to various ecological niches and photosynthetic strategies employed by green algae versus higher plants .

What expression systems are optimal for producing recombinant Staurastrum punctulatum ndhC?

Several expression systems can be employed for producing recombinant Staurastrum punctulatum ndhC, each with specific advantages:

  • E. coli expression systems: Using pET vector systems with BL21(DE3) or C41(DE3) strains (specialized for membrane proteins) offers high yields but may require optimization to address inclusion body formation. Expression should be induced at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.5 mM) to enhance proper folding.

  • Chlamydomonas reinhardtii expression: This green algae expression system provides a more native-like environment for chloroplast proteins, potentially enhancing proper folding and post-translational modifications. Transformation can be achieved using glass bead agitation or electroporation methods.

  • Insect cell expression: Baculovirus-mediated expression in Sf9 or Hi5 cells can be effective for membrane proteins that require eukaryotic processing machinery.

For optimal results, the ndhC coding sequence should be codon-optimized for the selected expression system and include appropriate purification tags (His6, Strep-tag II, or FLAG) at either the N- or C-terminus, with inclusion of protease cleavage sites for tag removal .

What purification strategies yield highest purity and activity for recombinant ndhC?

Purification of recombinant Staurastrum punctulatum ndhC requires specialized approaches due to its hydrophobic nature as a membrane protein:

  • Membrane preparation: Following cell disruption, differential centrifugation (10,000 × g for 20 minutes followed by 100,000 × g for 1 hour) isolates membrane fractions containing the expressed protein.

  • Detergent solubilization: Screening multiple detergents is recommended:

    • n-Dodecyl β-D-maltoside (DDM): 1-1.5% (w/v)

    • n-Decyl-β-D-maltopyranoside (DM): 1-2% (w/v)

    • Digitonin: 1-2% (w/v)

    • CHAPS: 0.5-1% (w/v)

  • Affinity chromatography: Utilizing the engineered affinity tag (Ni-NTA for His-tagged proteins) in the presence of detergent micelles (typically 0.05-0.1% DDM in running buffers).

  • Size exclusion chromatography: Final polishing step using Superdex 200 or similar matrices with appropriate detergent concentrations above critical micelle concentration.

Typical purification yields range from 0.2-0.5 mg protein per liter of bacterial culture. The purified protein shows optimal stability when stored at -80°C in buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and 0.03% DDM .

How can researchers assess the functional integrity of purified recombinant ndhC?

Evaluating the functional integrity of purified recombinant ndhC involves multiple complementary approaches:

  • Spectrophotometric assays: Monitoring NAD(P)H oxidation at 340 nm in the presence of quinone analogs (rate constants typically in the range of 1-5 μmol NAD(P)H oxidized/mg protein/min when functioning properly).

  • Reconstitution studies: Incorporating purified ndhC into liposomes or nanodiscs to assess membrane insertion and function in a lipid bilayer environment.

  • Co-immunoprecipitation: Evaluating interactions with other NDH complex subunits to confirm proper structural conformation.

  • Circular dichroism spectroscopy: Analyzing secondary structure content (expected: 60-70% α-helical content for properly folded protein).

  • Electron paramagnetic resonance (EPR): Detecting interactions with the electron transport chain components in reconstituted systems.

Researchers should implement at least three complementary methods to conclusively verify functional integrity, as membrane protein functionality is heavily dependent on proper folding and lipid environment .

What structural characterization methods are most effective for Staurastrum punctulatum ndhC?

Due to the challenging nature of membrane protein structure determination, multiple approaches should be employed:

  • Cryo-electron microscopy (cryo-EM): Increasingly the method of choice for membrane protein complexes, allowing visualization of ndhC within the larger NDH complex context at resolutions approaching 3-4 Å.

  • X-ray crystallography: Challenging but possible using specialized crystallization techniques:

    • Lipidic cubic phase (LCP) crystallization

    • Vapor diffusion with detergent screening

    • Bicelle crystallization methods

  • NMR spectroscopy: Solid-state NMR can provide structural information about membrane proteins in lipid environments, though sample preparation is demanding.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides insights into protein dynamics and solvent accessibility.

  • Molecular dynamics simulations: Complementary computational approach to predict structure-function relationships in membrane environments.

Integration of several approaches generally provides the most comprehensive structural understanding. Recent applications have achieved successful structural characterization of algal membrane proteins at resolutions of 3.5-5 Å using cryo-EM techniques combined with molecular dynamics refinement .

How can researchers investigate protein-protein interactions involving ndhC?

Investigating protein-protein interactions for ndhC requires specialized approaches for membrane proteins:

  • Cross-linking coupled with mass spectrometry (XL-MS): Using reagents like DSS, BS3, or EDC to identify interaction partners, with typical workflows involving:

    • In vivo or in vitro crosslinking

    • Protein digestion

    • LC-MS/MS analysis

    • Computational identification of crosslinked peptides

  • Co-immunoprecipitation with antibodies against ndhC or potential interaction partners: Can be performed in detergent-solubilized membranes with appropriate controls.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo validation of interactions, though challenging to implement in chloroplasts.

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics determination between purified components.

  • Yeast two-hybrid membrane protein systems: Modified Y2H systems developed specifically for membrane proteins can identify potential interaction partners.

Key interacting partners typically include other NDH complex subunits (ndhA, ndhB, ndhD-K) as well as ferredoxin and ferredoxin-NADP+ reductase for electron transfer activities. Interaction strength can be quantified using SPR with dissociation constants (Kd) typically in the micromolar range for authentic interactions .

What techniques best assess the electron transport activity of ndhC?

Electron transport activity can be assessed through several complementary approaches:

  • Oxygen electrode measurements: Monitoring oxygen consumption or evolution rates in the presence of appropriate substrates and inhibitors.

  • Chlorophyll fluorescence analysis: Measuring parameters such as NPQ (non-photochemical quenching) and electron transport rate (ETR) using PAM fluorometry.

  • Spectrophotometric assays:

    • NADPH oxidation (340 nm decrease)

    • Cytochrome c reduction (550 nm increase)

    • Plastoquinone reduction (follow absorbance changes at 255 nm)

  • Artificial electron acceptor/donor assays: Using compounds like ferricyanide, methyl viologen, or DCPIP to assess specific electron transfer steps.

  • Electrochemical methods: Protein film voltammetry can provide detailed kinetic parameters for electron transfer.

When properly functional, recombinant ndhC should facilitate electron transfer rates of approximately 100-200 electrons per second per reaction center under optimal conditions, with characteristic response curves to varying light intensities and temperatures .

How can recombinant ndhC be used to investigate cyclic electron flow?

Recombinant Staurastrum punctulatum ndhC serves as a valuable tool for studying cyclic electron flow (CEF) around Photosystem I through several experimental approaches:

  • Reconstitution experiments: Incorporating purified recombinant ndhC into proteoliposomes along with other photosynthetic components allows for controlled study of electron transport rates and pathways.

  • Complementation studies: Using the recombinant protein to rescue ndhC mutants enables assessment of structure-function relationships through site-directed mutagenesis.

  • Inhibitor binding studies: Analyzing how specific inhibitors (like rotenone derivatives) interact with wild-type versus mutant ndhC provides insights into electron transport mechanisms.

  • In vitro electron transport assays: Measuring the rates of NADPH oxidation coupled to quinone reduction with purified components can reveal kinetic parameters:

ParameterWild-type ndhCTypical mutantReconstituted system
Vmax (μmol/min/mg)3.2-4.50.5-1.22.3-3.8
Km for NADPH (μM)25-40Variable35-55
Sensitivity to antimycin ALowVariableLow
pH optimum7.5-8.0Often shifted7.5-8.0
  • Isotope labeling: Using 13C or 15N labeled ndhC in structural studies to precisely map interaction domains relevant to CEF function .

What role does ndhC play in photoprotection mechanisms?

The ndhC subunit contributes to photoprotection through several mechanisms that can be experimentally investigated:

  • High light response studies: Recombinant ndhC can be used in reconstituted systems to measure NDH complex activation under various light intensities, demonstrating increased activity (typically 2-3 fold) under high light conditions.

  • Reactive oxygen species (ROS) measurements: Systems with functional versus non-functional ndhC show significant differences in ROS production under stress conditions, with functional ndhC typically reducing H2O2 production by 30-45%.

  • pH gradient formation: The NDH complex containing ndhC contributes to lumen acidification, which can be measured using pH-sensitive fluorescent probes in reconstituted systems.

  • State transition analysis: ndhC function affects the balance of excitation energy between photosystems, which can be assessed using 77K fluorescence spectroscopy.

The relative contribution of ndhC to photoprotection varies by species and conditions but is typically most pronounced under fluctuating light conditions or during temperature stress, where it can improve photosynthetic efficiency by 15-25% compared to systems lacking functional ndhC .

How does ndhC contribute to NDH complex assembly and function?

The role of ndhC in NDH complex assembly can be investigated through several approaches:

  • Blue native PAGE analysis: Comparing NDH complex assembly patterns in systems with wild-type versus mutated or absent ndhC reveals the hierarchical assembly process.

  • Pulse-chase experiments: Using radioactively labeled amino acids to track the incorporation of newly synthesized ndhC into the NDH complex provides temporal information about assembly kinetics.

  • Immunoprecipitation with subcomplex-specific antibodies: Identifies intermediate assemblies that accumulate in the absence of functional ndhC.

  • Proteomic analysis of complex components: Quantitative proteomics can reveal which subunits are destabilized when ndhC is absent or mutated.

Research findings indicate that ndhC typically serves as a nucleation point for the membrane domain of the NDH complex, with assembly proceeding in a defined order:

  • Initial incorporation of ndhC with ndhE and ndhG to form a membrane subcomplex

  • Association with the ndhH-containing subcomplex

  • Addition of peripheral subunits

Disruption of ndhC typically results in a >80% reduction in assembled NDH complex, highlighting its essential role in the assembly process .

What are the current challenges in elucidating ndhC protein-protein interactions?

Researchers face several key challenges when investigating ndhC interactions:

  • Maintaining native interaction environments: Detergent solubilization can disrupt weak or transient interactions that occur in the lipid bilayer. Current approaches using styrene maleic acid lipid particles (SMALPs) or nanodiscs show promise for preserving the native lipid environment during purification.

  • Distinguishing direct from indirect interactions: In large complexes like NDH, determining which subunits directly contact ndhC versus associate through intermediate proteins requires specialized crosslinking approaches with arm-length defined reagents.

  • Temporal dynamics of interactions: Many interactions in the photosynthetic electron transport chain are state-dependent or transient. Time-resolved techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) with rapid mixing are being developed to capture these dynamics.

  • Low abundance of complexes: The NDH complex represents only approximately 1-2% of thylakoid membrane proteins, making detection of interactions challenging. New approaches using proximity labeling methods like BioID or APEX2 show promise for capturing these low-abundance interactions.

  • Species-specific variations: Interactions characterized in model systems may not directly translate to Staurastrum punctulatum. Comparative interaction mapping across species is needed to build comprehensive models .

How do mutations in ndhC affect photosynthetic efficiency?

Structure-function analysis of ndhC through mutagenesis reveals critical insights:

  • Conserved residue mutations: Modification of highly conserved residues in the transmembrane domains typically results in:

    • 50-90% reduction in NDH activity

    • Impaired proton pumping efficiency

    • Reduced cyclic electron flow around PSI

    • Decreased growth rates under fluctuating light (10-30% reduction)

  • Key functional mutations documented in research:

Mutation typeLocationFunctional impactPhenotypic consequence
Conserved histidine residuesTransmembrane helix 2Disrupted quinone binding75-85% reduction in activity
Glycine zipper motifsHelix interfacesImpaired subunit interactionComplex destabilization
C-terminal domainStromal loopAltered regulatory protein bindingMisregulation under stress
N-terminal modificationsMembrane interfaceDisrupted lipid interactionsReduced complex stability
  • Experimental approaches:

    • Site-directed mutagenesis of recombinant protein

    • Chloroplast transformation for in vivo analysis

    • Biophysical characterization of mutant proteins

    • Physiological phenotyping under various conditions

High-throughput mutagenesis approaches coupled with functional screening are revealing additional residues critical for ndhC function beyond those predicted from sequence conservation alone .

What comparative analyses can be performed between algal and higher plant ndhC?

Comparative analyses between Staurastrum punctulatum ndhC and higher plant homologs reveal evolutionary insights and functional adaptations:

  • Sequence analysis approaches:

    • Multiple sequence alignment with conservation scoring

    • Calculation of selection pressures (dN/dS ratios)

    • Identification of lineage-specific insertions/deletions

    • Motif conservation analysis

  • Structural comparisons:

    • Homology modeling based on available structures

    • Molecular dynamics simulations in membrane environments

    • Comparison of electrostatic surface properties

    • Analysis of coevolutionary networks within the protein

  • Functional conservation testing:

    • Heterologous complementation experiments

    • Domain swapping between algal and plant proteins

    • Biochemical characterization of chimeric proteins

  • Comparative expression patterns:

    • Transcriptional response to environmental stressors

    • Developmental regulation patterns

    • Circadian regulation of expression

Recent findings indicate that while the core electron transport function is conserved, regulatory elements have diverged significantly, with Staurastrum punctulatum ndhC showing unique adaptations related to aquatic environments and distinctive light harvesting strategies .

What are the optimal protocols for activity assays of ndhC?

Researchers should consider the following optimized protocols for ndhC activity assessment:

  • Standard spectrophotometric assay:

    • Reaction buffer: 50 mM HEPES-KOH (pH 7.5), 10 mM MgCl2, 2 mM KCN

    • Substrates: 100 μM NADPH, 50 μM ubiquinone-1 or plastoquinone analogs

    • Protein concentration: 5-20 μg purified protein per ml reaction

    • Monitor absorbance decrease at 340 nm (ε = 6.22 mM-1cm-1)

    • Temperature: 25°C for standard comparisons, variable for temperature-dependence studies

    • Controls: Heat-inactivated enzyme, specific inhibitors (rotenone at 10 μM)

  • Electrochemical approach:

    • Modified electrodes with immobilized protein

    • Direct measurement of electron transfer rates

    • Real-time monitoring of activity under varying conditions

    • Enhanced sensitivity for low abundance or low activity preparations

  • Fluorescence-based methods:

    • Using NAD(P)H autofluorescence (excitation 340 nm, emission 460 nm)

    • Alternative: coupling to resazurin reduction (excitation 530 nm, emission 590 nm)

    • Suitable for high-throughput screening applications

    • Greater sensitivity than absorbance-based methods (10-50 fold)

For accurate results, researchers should perform measurements under varying substrate concentrations to determine Michaelis-Menten kinetic parameters (typical Km values: 30-50 μM for NADPH, 15-25 μM for quinone acceptors) and include appropriate controls for non-enzymatic reaction rates .

How can isotope labeling be used to track electron flow through the NDH complex?

Isotope labeling provides powerful approaches for tracking electron flow:

  • 13C-labeled substrates:

    • Using 13C-labeled NADPH or glucose to follow carbon flux

    • Detection by mass spectrometry or NMR spectroscopy

    • Can distinguish between linear and cyclic electron pathways

    • Typical enrichment levels needed: 50-99% depending on detection method

  • 2H (deuterium) labeling:

    • Tracking proton movement coupled to electron transport

    • Can directly measure the proton pumping efficiency of the NDH complex

    • Typical approach: reconstitution of ndhC-containing complexes in liposomes with internal pH indicators

  • 15N labeling for protein dynamics:

    • Incorporation of 15N into specific subunits

    • NMR-based detection of structural changes during electron transport

    • Useful for identifying conformational changes coupled to catalysis

  • 18O labeling:

    • Tracing water splitting and oxygen evolution

    • Distinguishing between water sources in different cellular compartments

    • Measurement by membrane inlet mass spectrometry

Contemporary studies typically combine multiple isotopic labels with time-resolved measurements to create comprehensive models of electron and proton flow through the complex. Sensitivity has improved to allow detection of isotopic enrichment at levels as low as 0.01-0.1% above natural abundance .

What imaging techniques best visualize ndhC localization in chloroplasts?

Several imaging approaches can effectively visualize ndhC localization:

  • Immunogold electron microscopy:

    • Resolution: 5-10 nm

    • Sample preparation: High-pressure freezing followed by freeze substitution

    • Detection: Primary antibodies against ndhC, secondary antibodies conjugated to gold particles

    • Advantage: Highest resolution for precise localization within thylakoid membranes

    • Limitation: Complex sample preparation, potential for epitope masking

  • Confocal fluorescence microscopy with fluorescent protein fusions:

    • Resolution: 200-250 nm

    • Constructs: ndhC fused to GFP, YFP, or mCherry

    • Advantage: Live cell imaging possible, dynamic studies

    • Limitation: Size of fluorescent protein may alter localization

  • Super-resolution microscopy approaches:

    • STED microscopy: ~50 nm resolution

    • PALM/STORM: ~20-30 nm resolution

    • Requires specialized fluorophores and equipment

    • Enables visualization of ndhC distribution within thylakoid subdomains

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines the advantages of fluorescence and electron microscopy

    • Enables tracking of proteins from whole-cell to ultrastructural level

    • Recent advances allow for 3D reconstruction with ~25 nm resolution

  • Proximity labeling methods:

    • APEX2 or BioID fused to ndhC

    • Identifies neighboring proteins within 10-20 nm radius

    • Provides functional interaction context

Quantitative analysis of ndhC distribution typically reveals concentration in stromal thylakoids (70-80%) with lesser amounts in grana margins (15-25%) and minimal presence in grana stacks (1-5%) .

How should kinetic data for ndhC-mediated reactions be analyzed?

Proper analysis of ndhC kinetic data requires specialized approaches:

  • Steady-state kinetic analysis:

    • Fit initial velocity data to appropriate models:

      • Michaelis-Menten for simple kinetics

      • Hill equation when cooperativity is observed

      • Bi-substrate models (ping-pong or sequential) for complete analysis

    • Software recommendations: GraphPad Prism, DynaFit, or KinTek Explorer

    • Statistical validation: Residual analysis, F-test for model discrimination

  • Progress curve analysis:

    • Global fitting of complete reaction time courses

    • Can reveal product inhibition, enzyme inactivation

    • Typically requires specialized software like KinTek Explorer

  • Transient kinetic approaches:

    • Stopped-flow spectroscopy for millisecond timescale events

    • Rapid quench-flow for chemical intermediate detection

    • Global fitting with numerical integration of rate equations

  • Temperature dependence analysis:

    • Arrhenius plots to determine activation energy

    • Eyring analysis for thermodynamic parameters

    • Typical activation energies for functional ndhC: 30-45 kJ/mol

  • pH dependence analysis:

    • Plot activity versus pH to identify key ionizable groups

    • pKa determination for catalytic residues

    • Bell-shaped curves often observed with optimal pH 7.2-7.8

For complex electron transport processes, mechanism-based modeling integrating multiple datasets is recommended over simple Michaelis-Menten analysis. Models should account for the multi-step nature of electron transfer through the NDH complex .

What statistical approaches are appropriate for comparing ndhC activity across conditions?

Appropriate statistical analysis ensures robust interpretation of ndhC activity data:

  • Parametric approaches:

    • Student's t-test for comparing two conditions (with verification of normality)

    • ANOVA followed by post-hoc tests (Tukey's or Dunnett's) for multiple comparisons

    • Repeated measures designs for time-course experiments

    • Sample size recommendations: minimum n=5 independent preparations

  • Non-parametric alternatives:

    • Mann-Whitney U test or Wilcoxon signed-rank test when normality cannot be assured

    • Kruskal-Wallis followed by Dunn's test for multiple comparisons

    • Often more appropriate for activity data that may not follow normal distributions

  • Regression approaches for continuous variables:

    • Linear regression for simple relationships

    • Non-linear regression for complex responses (e.g., light response curves)

    • Mixed-effects models when incorporating random factors

  • Multivariate approaches:

    • Principal Component Analysis (PCA) for exploring patterns across multiple variables

    • Partial Least Squares (PLS) regression for relating enzyme characteristics to functional outcomes

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes (typically n=6-10 for biochemical assays)

    • Inclusion of appropriate positive and negative controls

    • Randomization of sample processing order

    • Blinding where feasible to minimize bias

All statistical analyses should report effect sizes along with p-values, and should include clear statements about the assumptions tested and met .

How can researchers distinguish between direct and indirect effects of ndhC manipulation?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Time-resolved experiments:

    • Monitor the temporal sequence of events following ndhC manipulation

    • Immediate effects (seconds to minutes) are more likely direct

    • Delayed responses (hours to days) often represent indirect adaptations

    • High-temporal resolution techniques like time-resolved fluorescence or spectroscopy can capture immediate effects

  • Dose-response relationships:

    • Direct effects typically show clear dose-dependency

    • Examine correlation between ndhC activity level and physiological response

    • Threshold effects often indicate regulatory networks rather than direct action

  • Genetic complementation strategies:

    • Site-specific mutations affecting only specific functions

    • Rescue experiments with minimal functional domains

    • Creation of chimeric proteins with defined functional properties

  • In vitro reconstitution:

    • Isolated component systems demonstrate direct effects

    • Comparison with in vivo results identifies potential indirect contributions

    • Systematic addition of components can reveal minimal requirements for specific functions

  • Network analysis approaches:

    • Transcriptomic profiling following ndhC manipulation

    • Metabolomic analysis to identify pathway alterations

    • Construction of causal networks from multiple data types

How to address low expression yields of recombinant ndhC?

Researchers encountering low expression yields can implement several optimization strategies:

  • Expression construct optimization:

    • Codon optimization specifically for expression host (CAI > 0.8)

    • Evaluation of multiple affinity tags (N-terminal vs. C-terminal)

    • Testing of different promoter strengths

    • Inclusion of translation enhancing sequences (e.g., Shine-Dalgarno sequence optimization)

  • Host strain selection:

    • For E. coli: C41(DE3), C43(DE3), or Lemo21(DE3) strains designed for membrane proteins

    • Consider strains with additional chaperones (e.g., BL21-CodonPlus-RP)

    • Evaluate Lactococcus lactis or Bacillus subtilis as alternative bacterial hosts

  • Expression condition optimization:

    • Reduced temperature (16-20°C)

    • Lower inducer concentration (0.1-0.3 mM IPTG)

    • Extended expression time (24-48 hours)

    • Rich vs. minimal media comparison

    • Addition of specific phospholipids to growth media (0.05-0.1% w/v)

  • Solubilization screening:

    • Systematic testing of detergent panel (DDM, LMNG, GDN, CHAPS, SMA copolymers)

    • Optimization of detergent concentration (typically 1-5× CMC)

    • Addition of stabilizing lipids (POPC, POPE at 0.1-0.2 mg/ml)

    • Inclusion of glycerol (10-15%) or specific stabilizing additives

  • Alternative expression technologies:

    • Cell-free expression systems (E. coli extracts supplemented with nanodiscs or liposomes)

    • Fusion to highly expressed carrier proteins (MBP, SUMO, Mistic)

    • Evaluation of eukaryotic systems for complex membrane proteins

Implementing these strategies has been shown to improve yields from undetectable levels to 0.5-2 mg/L culture for challenging membrane proteins like ndhC .

What are common pitfalls in ndhC activity assays and their solutions?

Several common pitfalls affect ndhC activity assays:

  • Non-specific background activity:

    • Problem: Contaminating oxidoreductases can give false positive results

    • Solution: Include proper controls (heat-inactivated enzyme, reactions without substrate)

    • Solution: Use specific inhibitors to distinguish NDH activity from alternatives

  • Detergent interference:

    • Problem: Detergents can affect substrate accessibility and enzyme stability

    • Solution: Optimize detergent type and concentration (typically 2-3× CMC for assay conditions)

    • Solution: Consider reconstitution into nanodiscs or liposomes for more native-like environment

  • Substrate quality issues:

    • Problem: Quinone substrates can auto-oxidize or have variable quality

    • Solution: Prepare fresh solutions under nitrogen, protect from light

    • Solution: Include appropriate blank reactions to correct for auto-oxidation

  • Cofactor dependencies overlooked:

    • Problem: Essential cofactors may be lost during purification

    • Solution: Supplement assays with potential cofactors (iron-sulfur cluster precursors, divalent cations)

    • Solution: Screen for optimal cofactor concentrations

  • Time-dependent activity loss:

    • Problem: Rapid inactivation during assay procedures

    • Solution: Minimize delay between preparation and assay

    • Solution: Include stabilizing agents (glycerol, reducing agents)

    • Solution: Perform time-course measurements to account for inactivation

Using appropriate controls and performing assays under multiple conditions help ensure reliable and reproducible activity measurements. Researchers should report detailed assay conditions to facilitate comparison between studies .

How to resolve inconsistencies in experimental results with ndhC?

When facing inconsistent results, researchers should implement systematic troubleshooting:

  • Protein quality assessment:

    • Verify protein integrity by SDS-PAGE and western blotting

    • Assess aggregation state by size exclusion chromatography

    • Confirm identity by mass spectrometry

    • Test fresh preparations vs. stored samples for activity loss

  • Method standardization:

    • Implement detailed standard operating procedures

    • Use internal standards for normalization between experiments

    • Calibrate instruments regularly

    • Consider round-robin testing between laboratory members

  • Variable tracking:

    • Document all experimental variables systematically

    • Monitor laboratory environmental conditions (temperature, humidity)

    • Track reagent lots and preparation dates

    • Maintain detailed electronic laboratory notebooks

  • Biological variability considerations:

    • Distinguish technical from biological replicates

    • Increase sample size to account for inherent variability

    • Consider circadian or growth-phase effects on activity

    • Test multiple independent protein preparations

  • Advanced troubleshooting approaches:

    • Design factorial experiments to identify interacting variables

    • Implement statistical process control methods

    • Use orthogonal methods to verify key findings

    • Consider blind testing protocols to eliminate unconscious bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.