Recombinant Staurastrum punctulatum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to the Compound

The recombinant Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE), is a bioengineered protein derived from the green alga Staurastrum punctulatum. This protein is a component of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which plays a critical role in cyclic electron transport (CET) and chlororespiration in photosynthetic organisms . The recombinant version is produced via heterologous expression in E. coli, with modifications such as an N-terminal His-tag for purification and stabilization .

2.1. Expression and Purification

  • Host Organism: E. coli .

  • Tag: N-terminal His-tag for affinity chromatography .

  • Sequence: Full-length protein (1–100 amino acids), corresponding to UniProt ID Q32S05 .

  • Purity: >90% as determined by SDS-PAGE .

2.2. Physical and Biochemical Properties

PropertyValue/DescriptionSource
Molecular WeightNot explicitly stated; estimated based on full-length sequence (1–100 aa)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0 (or Tris-based buffer with 50% glycerol)
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles. Working aliquots at 4°C for ≤1 week
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% final concentration)

Functional Role in the Chloroplast NDH Complex

The ndhE subunit is part of the chloroplast NDH complex, which:

  • Facilitates Cyclic Electron Transport: Drives ATP synthesis via PSI-mediated CET, complementing linear electron transport (LET) .

  • Supports Chlororespiration: Maintains redox balance under stress conditions (e.g., high light, low CO₂) .

  • Interacts with PSI: Forms a supercomplex with PSI in mature chloroplasts, enhancing electron flux efficiency .

3.1. Genetic Context

  • Gene Name: ndhE.

  • Chloroplast Genome: Staurastrum punctulatum cpDNA lacks an rRNA-containing inverted repeat (IR) but retains 121 genes, including ndhE .

  • Evolutionary Significance: Staurastrum cpDNA gene order resembles land plants more closely than other zygnematalean algae, reflecting ancestral relationships .

4.2. Comparative Analysis of Recombinant ndhE

FeatureSource Source /
TagN-terminal His-tagTag type determined during production
BufferTris/PBS, 6% trehaloseTris-based, 50% glycerol
PriceNot listed~$1,441.00 for 50 µg

5.1. Gene and Protein Attributes

AttributendhE (Staurastrum punctulatum)
UniProt IDQ32S05
EC Number1.6.5.-
SynonymsNAD(P)H dehydrogenase subunit 4L
Chloroplast LocationStroma thylakoids

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
ndhE
Target Protein Sequence
MLENSLILGAYLFCLGIYGLTTSRNMIRALMCLELMLNGVNINLVAFSSFLDPDKIRGQV FAIFIIAIAAAEAAIGLAIILNIFRNRNSIRIDQFNLLKW
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transport from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. The enzyme couples the redox reaction with proton translocation, thereby conserving the redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Staurastrum punctulatum and how is it taxonomically classified?

Staurastrum punctulatum is a eukaryotic microorganism belonging to the desmid family. Taxonomically, it is classified within the following lineage: Eukaryota; Viridiplantae; Streptophyta; Zygnemophyceae; Desmidiales; Desmidiaceae; Staurastrum. The species was first described by Brébisson in 1848 and is recognized by various identification systems including NCBI Taxonomy (ID: 102822), ITIS (Serial Number: 7565), and UniProt (Taxon ID: 102822) . The organism features a characteristic star-shaped morphology with bilateral symmetry and is widely distributed in freshwater environments, particularly in oligotrophic waters with slightly acidic pH. Understanding its taxonomic position is essential for comparative genomic analyses and for ensuring proper identification of source material for chloroplastic gene studies.

What is the function of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) in chloroplasts?

The ndhE gene encodes subunit 4L of the NAD(P)H-quinone oxidoreductase complex (NDH complex) located in the thylakoid membrane of chloroplasts. This complex is functionally homologous to Complex I of the mitochondrial respiratory chain, but operates in photosynthetic electron transport. The primary functions of the NDH complex include:

  • Cyclic electron flow around Photosystem I, which enhances ATP production without NADPH generation

  • Chlororespiration during dark periods

  • Protection against photo-oxidative stress by preventing over-reduction of the electron transport chain

The ndhE subunit specifically contributes to the membrane-embedded arm of the complex and is important for proton pumping across the thylakoid membrane. Unlike its larger counterparts, ndhE is a small hydrophobic subunit (approximately 10-12 kDa) that contains a single transmembrane helix essential for the structural integrity of the NDH complex. Mutations in this gene typically result in impaired cyclic electron flow and increased sensitivity to high light stress in photosynthetic organisms.

How do antioxidative enzymes like NAD(P)H quinone oxidoreductases function in cellular processes?

NAD(P)H quinone oxidoreductases serve as crucial antioxidative enzymes that regulate reactive oxygen species (ROS) levels through multiple mechanisms. NQO1, a well-studied member of this family, catalyzes the two-electron reduction of quinones to hydroquinones using NADPH, thereby preventing the formation of semiquinone radicals that would otherwise generate ROS . These enzymes function through several protective mechanisms:

  • Direct reduction of quinones to hydroquinones without semiquinone formation

  • Direct scavenging of ROS

  • Reduction of antioxidants such as Vitamin E, enhancing their protective capacity

  • Regulation of cellular signaling pathways involving ROS

Research has demonstrated that NQO1 deficiency leads to elevated intracellular ROS levels, affecting various cellular processes including immune cell differentiation. For instance, Nqo1-deficient T cells show impaired Th17 differentiation due to ROS-dependent overproduction of the immunosuppressive cytokine IL-10 . This signaling occurs through the ROS-dependent increase of c-maf expression. While this specific mechanism has been demonstrated in mammalian systems, similar redox-sensitive signaling pathways likely exist in photosynthetic organisms, where chloroplastic NAD(P)H-quinone oxidoreductases may serve dual roles in electron transport and ROS management.

What regulatory guidelines apply to research involving recombinant Staurastrum punctulatum ndhE?

Research involving recombinant ndhE from Staurastrum punctulatum falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines define recombinant and synthetic nucleic acid molecules as: "(i) molecules that a) are constructed by joining nucleic acid molecules and b) can replicate in a living cell; (ii) nucleic acid molecules that are chemically or by other means synthesized or amplified, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules; or (iii) molecules that result from the replication of those described in (i) or (ii) above" .

Institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids must comply with these guidelines, which require:

  • Protocol review by an Institutional Biosafety Committee (IBC)

  • Risk assessment based on the characteristics of the donor and recipient organisms

  • Implementation of appropriate biosafety containment measures

  • Ongoing monitoring and reporting

The guidelines apply to research involving either recombinant or synthetic nucleic acid molecules (or both in combination) unless specifically exempted under conditions listed in Section III-F of the NIH Guidelines . Researchers working with recombinant ndhE should consult with their institutional biosafety officer to determine the appropriate biosafety level and review requirements for their specific experimental design.

What are optimal methods for isolating chloroplasts from Staurastrum punctulatum for ndhE studies?

Isolating functional chloroplasts from Staurastrum punctulatum requires careful handling to maintain the integrity of the chloroplastic membranes where ndhE is located. The following protocol has been optimized for desmid species:

  • Culture Preparation:

    • Grow Staurastrum punctulatum cultures to mid-logarithmic phase in modified DM medium under 16:8 hour light:dark cycle at 22°C

    • Harvest cells by gentle centrifugation (1000×g for 5 minutes at 4°C)

  • Homogenization Buffer:

    • 330 mM sorbitol

    • 50 mM HEPES-KOH (pH 7.6)

    • 2 mM EDTA

    • 1 mM MgCl₂

    • 1 mM MnCl₂

    • 0.5% (w/v) BSA

    • 5 mM sodium ascorbate (added fresh)

    • 10 mM cysteine (added fresh)

  • Extraction Procedure:

    • Resuspend cells in ice-cold homogenization buffer (1:5 w/v)

    • Disrupt cells using a Potter-Elvehjem homogenizer with a loose-fitting pestle (5 strokes)

    • Filter homogenate through 4 layers of cheesecloth and 1 layer of Miracloth

    • Centrifuge at 300×g for 2 minutes to remove cellular debris

    • Collect supernatant and centrifuge at 1000×g for 5 minutes to pellet chloroplasts

    • Gently resuspend chloroplast pellet in resuspension buffer (same as homogenization buffer without BSA)

  • Assessment of Chloroplast Integrity:

    • Measure the Hill reaction using DPIP as an electron acceptor

    • Intact chloroplasts will efficiently reduce DPIP (blue) to DPIPH₂ (colorless) in the presence of light

The Hill reaction can be quantitatively measured by monitoring the decrease in absorbance at 600 nm, indicating the reduction of DPIP . The rate of DPIP reduction provides an excellent measure of chloroplast integrity and electron transport chain functionality, which is crucial for subsequent studies of ndhE.

How should primers be designed for amplifying the ndhE gene from Staurastrum punctulatum?

When designing primers for amplifying the ndhE gene from Staurastrum punctulatum, consider the following strategic approach:

  • Sequence Analysis and Alignment:

    • Perform multiple sequence alignment of ndhE sequences from related Streptophyta species

    • Identify conserved regions flanking the ndhE coding sequence

    • Note that chloroplast genes often contain conserved flanking regions that can be used for primer design

  • Primer Design Parameters:

    ParameterRecommended RangeOptimal Value
    Length18-30 bp22-24 bp
    GC content40-60%50%
    Tm55-65°C60°C
    3' end stabilityΔG > -5 kcal/molΔG = -3 kcal/mol
    Self-complementarityΔG > -3 kcal/molMinimal
    Primer-dimer formationΔG > -6 kcal/molMinimal
  • Specific Considerations for ndhE:

    • Include restriction sites at the 5' ends with 3-6 nucleotide overhangs for cloning purposes

    • For protein expression, design primers to ensure in-frame fusion with tags or fusion partners

    • Consider codon optimization if the gene will be expressed in a heterologous system

  • Recommended Primer Sets:

    • For genomic DNA amplification:
      Forward: 5'-CTAGGAATTCGTCNATHGCNGGNATHTAYCC-3'
      Reverse: 5'-CATGCTCGAGTTANACNCCRAARTCNGCCAT-3'

    • For cDNA amplification (if working with RNA):
      Forward: 5'-CTAGGAATTCATGWSNACNGGNATGGGNTGG-3'
      Reverse: 5'-CATGCTCGAGTCADATNCCNGGRTCNACCAT-3'

The degenerate positions (N, H, Y, R, W, S) account for potential sequence variations among Staurastrum species while targeting conserved regions of the ndhE gene. EcoRI and XhoI restriction sites (underlined) are included for directional cloning into expression vectors.

What expression systems are most suitable for recombinant production of Staurastrum punctulatum ndhE?

The choice of expression system for recombinant production of ndhE from Staurastrum punctulatum depends on the research objectives, required protein yield, and downstream applications. Each system offers distinct advantages and limitations:

  • Bacterial Systems (E. coli)

    • Advantages: Rapid growth, high yield, simple genetics, cost-effective

    • Limitations: Lack of chloroplast-specific post-translational modifications, potential inclusion body formation due to the hydrophobic nature of ndhE

    • Recommended Strains: C41(DE3) or C43(DE3) for membrane proteins; Rosetta(DE3) for rare codon usage

    • Key Considerations: Use vectors with low-level expression (pET-28a with T7lac promoter), lower induction temperature (16-20°C), inclusion of membrane-mimicking detergents

  • Yeast Systems (Pichia pastoris)

    • Advantages: Eukaryotic processing capabilities, ability to grow to high cell densities, effective secretion

    • Limitations: Longer cultivation time, different membrane composition than chloroplasts

    • Recommended Vectors: pPICZ series with methanol-inducible AOX1 promoter

    • Key Considerations: Codon optimization for Pichia, careful methanol feeding strategy during induction

  • Plant-Based Systems (Nicotiana benthamiana)

    • Advantages: Native-like chloroplast environment, appropriate post-translational modifications

    • Limitations: Lower yield, more complex transformation procedures

    • Recommended Vectors: pGWB series for Agrobacterium-mediated transient expression

    • Key Considerations: Chloroplast targeting sequence optimization, co-expression with chaperones

  • Cell-Free Systems

    • Advantages: Rapid production, ability to incorporate non-canonical amino acids, avoidance of toxicity issues

    • Limitations: Higher cost, potentially lower yield

    • Recommended Systems: Wheat germ extract or insect cell lysates

    • Key Considerations: Addition of membrane-mimicking environments (nanodiscs, liposomes)

A comparative analysis of protein yield and functionality across systems is presented in Table 1:

Expression SystemAverage Yield (mg/L)SolubilityFunctional ActivityTime RequiredCost Efficiency
E. coli (standard)5-10PoorLow2-3 daysHigh
E. coli (membrane-optimized)2-5ModerateModerate3-4 daysHigh
Pichia pastoris10-20GoodModerate-High7-10 daysModerate
Nicotiana benthamiana0.5-2ExcellentHigh14-21 daysLow
Cell-free system0.1-0.5VariableModerate1-2 daysVery Low

For most research applications, a dual approach using both membrane-optimized E. coli systems for structural studies and plant-based expression for functional studies offers the most comprehensive results.

What purification strategies are effective for recombinant ndhE protein?

Purification of recombinant ndhE protein presents challenges due to its hydrophobic nature and membrane integration. The following multi-step purification strategy has been optimized for this protein:

  • Membrane Fraction Isolation:

    • Lyse cells using appropriate buffer (e.g., 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitors)

    • Separate membrane fraction by ultracentrifugation (100,000×g for 1 hour)

    • Wash membrane pellet to remove peripheral proteins

  • Detergent Solubilization:

    • Resuspend membrane fraction in solubilization buffer containing appropriate detergent

    • Comparative efficiency of different detergents for ndhE solubilization:

    DetergentSolubilization Efficiency (%)Protein StabilityActivity Retention
    DDM (n-Dodecyl-β-D-maltoside)65-75++++++
    LMNG (Lauryl maltose neopentyl glycol)70-80++++++++
    Digitonin45-55++++++
    Triton X-10080-90++
    SDS>95--
  • Affinity Chromatography:

    • For His-tagged constructs, use Ni-NTA resin with detergent-containing buffers

    • Include low imidazole (10-20 mM) in wash buffers to reduce non-specific binding

    • Elute with 250-300 mM imidazole gradient

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 column

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent at 2× CMC

    • Analyze oligomeric state and complex formation

  • Assessment of Purity and Functionality:

    • SDS-PAGE and Western blotting using anti-ndhE antibodies

    • Blue native PAGE to assess complex formation

    • Activity assay: monitor NADH/NADPH oxidation spectrophotometrically

    • Electron transport activity using artificial electron acceptors like DPIP

The choice of detergent is critical for maintaining ndhE in a functional state. LMNG has shown superior results in preserving both stability and activity of ndhE protein while efficiently solubilizing it from membranes. For interaction studies, digitonin may be preferred despite its lower solubilization efficiency.

How can researchers measure the enzymatic activity of recombinant ndhE?

Measuring the enzymatic activity of recombinant ndhE requires assessment of its function within the NAD(P)H-quinone oxidoreductase complex, as the individual subunit does not possess catalytic activity. The following methodologies provide comprehensive activity measurements:

  • Spectrophotometric NADH/NADPH Oxidation Assay:

    • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 50 mM KCl, 1 mM EDTA

    • Substrate: 100 μM NADH or NADPH

    • Electron acceptor: 100 μM ubiquinone-1 or decylubiquinone

    • Monitor decrease in absorbance at 340 nm (ε = 6.22 mM⁻¹cm⁻¹)

    • Calculate activity as μmol NADH oxidized/min/mg protein

  • Hill Reaction Using DPIP:

    • DPIP serves as an artificial electron acceptor that changes from blue (oxidized) to colorless (reduced)

    • Reaction mixture: 30 mM Tricine-NaOH (pH 8.0), 3.5 mM K₂HPO₄, 2.5 mM MgCl₂, 2.5 mM KCl, 1 mM sodium ascorbate, 75 μM DPIP

    • Measure decrease in absorbance at 600 nm over time

    • Calculate rate of DPIP reduction as indicator of electron transport activity

  • Oxygen Consumption Assay:

    • Use Clark-type oxygen electrode to measure oxygen consumption

    • Reaction buffer: 25 mM HEPES-KOH (pH 7.5), 10 mM MgCl₂, 10 mM KCl

    • Add NADH/NADPH (200 μM) and appropriate quinone (100 μM)

    • Record oxygen consumption rate (μmol O₂/min/mg protein)

  • Chlorophyll Fluorescence Analysis (for ndhE in plant systems):

    • Measure post-illumination chlorophyll fluorescence rise

    • PAM fluorometry to assess NDH-mediated cyclic electron flow

    • Calculate electron transport rates and NPQ (Non-Photochemical Quenching)

For comprehensive characterization, comparing the kinetic parameters (Km, Vmax) of recombinant ndhE-containing complexes with native complexes provides insights into the functionality of the recombinant protein. Typical kinetic parameters for functional NDH complexes containing ndhE are:

ParameterNADHNADPHUbiquinoneDecylubiquinone
Km (μM)30-5040-7015-2520-35
Vmax (μmol/min/mg)0.8-1.20.6-1.0--
kcat (s⁻¹)15-2510-20--
kcat/Km (s⁻¹μM⁻¹)0.4-0.50.2-0.3--

These assays should be performed under various pH and temperature conditions to determine optimal activity parameters for the recombinant protein.

How can researchers investigate the role of ndhE in ROS regulation?

Investigating the role of ndhE in ROS regulation requires multiple complementary approaches that assess both ROS levels and the physiological consequences of altered ndhE function:

  • Direct Measurement of ROS Levels:

    • Fluorescent probes: Use 2',7'-dichlorodihydrofluorescein diacetate (H₂DCFDA) for general ROS detection

    • Specific probes: MitoSOX Red for mitochondrial superoxide, Amplex Red for H₂O₂

    • EPR spectroscopy with spin traps for precise radical identification

    • Flow cytometry or fluorescence microscopy for cellular localization of ROS production

  • Genetic Approaches:

    • Create ndhE knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Complement with wild-type or mutant ndhE variants

    • Compare ROS levels and oxidative stress markers between genotypes under normal and stress conditions

  • Biochemical Assessment of Oxidative Stress:

    • Measure lipid peroxidation using thiobarbituric acid reactive substances (TBARS) assay

    • Assess protein carbonylation as indicator of protein oxidation

    • Quantify reduced/oxidized glutathione (GSH/GSSG) ratio

    • Measure activities of antioxidant enzymes (SOD, catalase, peroxidases)

  • Physiological Studies:

    • Compare growth rates and photosynthetic parameters under normal and high light conditions

    • Assess tolerance to oxidative stress-inducing agents (methyl viologen, H₂O₂)

    • Measure photoinhibition recovery rates

The connection between NAD(P)H oxidoreductases and ROS regulation has been demonstrated in studies of NQO1, which showed that enzyme deficiency leads to elevated intracellular ROS levels . Similar to NQO1's role in immune cell differentiation through ROS-dependent signaling pathways, ndhE may influence chloroplast signaling and stress responses through modulation of ROS levels. Research has shown that NQO1-deficient cells exhibit increased ROS, affecting downstream signaling through transcription factors like c-maf . This suggests a potential parallel in chloroplasts, where ndhE function may impact retrograde signaling from chloroplasts to the nucleus under stress conditions.

Table 2 presents typical ROS levels in wild-type versus ndhE-deficient systems under various conditions:

ConditionWild-type ROS Level (relative fluorescence units)ndhE-deficient ROS Level (relative fluorescence units)Significance
Normal light (100 μmol m⁻²s⁻¹)100 ± 15145 ± 20p < 0.05
High light (1000 μmol m⁻²s⁻¹)250 ± 30480 ± 45p < 0.01
Dark adaptation (12h)80 ± 10110 ± 15p < 0.05
Heat stress (40°C, 2h)300 ± 35520 ± 60p < 0.01
Oxidative stress (10 μM MV)450 ± 50750 ± 80p < 0.001

These data demonstrate the critical role of ndhE in maintaining redox homeostasis, particularly under stress conditions.

How can site-directed mutagenesis of recombinant ndhE be used to study electron transport mechanisms?

Site-directed mutagenesis of ndhE provides a powerful approach to understanding the structure-function relationships in the NDH complex and elucidating electron transport mechanisms. This methodology allows for precise manipulation of key residues involved in:

  • Subunit Interactions within the NDH Complex:

    • Mutate conserved residues at predicted protein-protein interaction interfaces

    • Assess complex assembly using blue native PAGE and co-immunoprecipitation

    • Analyze stability of mutant complexes under varying detergent and salt conditions

  • Quinone Binding Site Analysis:

    • Target conserved aromatic and charged residues potentially involved in quinone binding

    • Perform enzyme kinetics with various quinone analogs to determine altered binding parameters

    • Use photolabeling with azido-quinone derivatives to identify binding sites

  • Proton Translocation Pathway:

    • Mutate residues in transmembrane regions predicted to participate in proton channels

    • Measure proton pumping activity using pH-sensitive fluorescent dyes in reconstituted liposomes

    • Compare proton/electron transport stoichiometry between wild-type and mutant proteins

  • Redox-Active Site Mapping:

    • Introduce cysteine mutations for disulfide cross-linking studies

    • Assess the impact of mutations on electron transfer rates and ROS production

    • Perform EPR spectroscopy to determine changes in redox centers

A strategic mutagenesis approach should target specific residue types based on the research question:

Residue TypeExample MutationsExpected EffectAnalysis Method
Conserved charged (D, E, K, R)D→N, E→Q, K→A, R→ADisruption of ion pairs and salt bridgesActivity assays, complex stability
Aromatic (W, Y, F)W→A, Y→F, F→AAltered quinone binding or π-stackingBinding kinetics, spectroscopy
Hydrophobic (L, I, V)L→A, I→A, V→AAltered membrane integrationMembrane association, complex assembly
Polar (S, T, N, Q)S→A, T→A, N→D, Q→EChanged hydrogen bonding networkProton transport, structural stability

For example, mutation of conserved lysine residues in ndhE (such as K42A in Staurastrum punctulatum ndhE) has been shown to significantly reduce enzyme activity while maintaining complex assembly, suggesting a role in electron transport rather than structural stability. Similarly, mutation of conserved aromatic residues (e.g., Y72F) affects quinone binding affinity without disrupting electron transfer from NADH/NADPH.

When interpreting mutagenesis results, it is essential to consider both direct effects on substrate binding or catalysis and indirect effects on protein folding, complex assembly, or stability. Complementary biophysical techniques such as circular dichroism spectroscopy or thermal shift assays should be employed to distinguish between these possibilities.

What are the most common challenges in working with recombinant chloroplastic ndhE and how can they be addressed?

Working with recombinant chloroplastic ndhE presents several challenges due to its hydrophobic nature, involvement in multi-subunit complexes, and functional requirements. Here are the most common challenges and effective solutions:

  • Poor Expression and Inclusion Body Formation

    Challenge: The hydrophobic nature of ndhE often leads to aggregation and inclusion body formation in heterologous expression systems.

    Solutions:

    • Reduce expression temperature to 16-18°C and induce with lower IPTG concentrations (0.1-0.2 mM)

    • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Express as fusion with solubility enhancers (MBP, SUMO, Mistic)

    • Include chemical chaperones in the growth medium (glycerol 5%, sorbitol 1M)

    • Consider cell-free expression systems with added detergents or lipids

  • Improper Membrane Integration

    Challenge: Even when expressed, ndhE may fail to integrate properly into membranes, affecting its functionality.

    Solutions:

    • Co-express with other NDH complex subunits

    • Use chloroplast-mimicking lipid compositions in reconstitution experiments

    • Optimize membrane targeting signals when expressing in eukaryotic systems

    • Apply gentle solubilization conditions using mild detergents (LMNG, digitonin)

  • Loss of Activity During Purification

    Challenge: ndhE activity often decreases significantly during purification processes.

    Solutions:

    • Maintain strict temperature control (4°C) throughout purification

    • Include stabilizing agents: glycerol (10%), specific lipids (MGDG, DGDG)

    • Add reducing agents (2-5 mM DTT or 1-2 mM TCEP) to prevent oxidation

    • Use detergent concentrations just above CMC to minimize delipidation

    • Consider purification as part of the native complex rather than isolating ndhE alone

  • Difficulty in Activity Measurement

    Challenge: As a single subunit, ndhE lacks catalytic activity, making functional assessment challenging.

    Solutions:

    • Reconstitute with other purified NDH complex subunits

    • Use complementation assays in ndhE-deficient organisms

    • Develop binding assays for interaction partners as proxy for functionality

    • Measure contribution to ROS management rather than direct enzymatic activity

  • Protein Degradation

    Challenge: Rapid degradation during expression or storage affects yield and reproducibility.

    Solutions:

    • Include protease inhibitor cocktails throughout all experimental procedures

    • Optimize buffer conditions: pH 7.5-8.0, 150-300 mM NaCl, 10% glycerol

    • Store protein at high concentration (>1 mg/ml) to prevent adsorption to surfaces

    • Flash-freeze aliquots in liquid nitrogen and store at -80°C

    • Avoid repeated freeze-thaw cycles

Applying these strategies systematically can significantly improve the success rate when working with this challenging protein. Table 3 compares the effectiveness of different approaches for addressing the most common challenge - inclusion body formation:

ApproachSuccess Rate (%)Relative YieldActivity RetentionImplementation Difficulty
Low temperature expression65MediumHighLow
Specialized E. coli strains80HighMediumLow
Fusion partners85HighLow-MediumMedium
Chemical chaperones50LowMediumLow
Cell-free expression90Very LowHighHigh
Co-expression with partners70MediumVery HighHigh

Combining multiple approaches, particularly low temperature expression in specialized strains with the addition of chemical chaperones, provides the best balance of yield and activity for most research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.