Recombinant Staurastrum punctulatum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Staurastrum punctulatum (Green alga) (Cosmoastrum punctulatum)
Target Names
psbB
Target Protein Sequence
MALPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGVTKSWGGWSITGETITNAGLWSYEGVAATHIILSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGLTGNVQP VIPAWGAEGFDPFNPGGIASHHIAAGILGIIAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFWAAFVVAGTMWYGSAATPVELFGPTRYQWDQGYFQQEIERRIRTSLDEGLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGNELFVRRMP TFFETFPVVLLDKDGVVRADVPFRRAESKYSIEQVGVSVEFYGGELNGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHANFALLFFFGHIWHGSRTLFRDVFS GIDPDLESQVEFGLFQKLGDPTTRKQAV
Uniprot No.

Target Background

Function
CP47, one of the core complex components of photosystem II (PSII), plays a crucial role in chlorophyll binding and catalyzing the primary light-induced photochemical processes of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently utilized for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Staurastrum punctulatum and why is it significant for photosynthesis research?

Staurastrum punctulatum is a unicellular green alga belonging to the placoderm desmids, characterized by its distinctive hour-glass shaped cells (30 x 25 μm) with broadly rounded angles. The cell wall is uniformly covered with relatively coarse granules that are often slightly flattened. The cells exhibit a distinctive sinus that opens widely with approximately rectangular apices . This organism typically inhabits acidic bogs and moorland pools, where it is quite common and widely distributed, at least in regions like the Netherlands .

S. punctulatum has gained scientific significance as a representative model organism for studying photosynthetic machinery in the charophycean lineage of green algae, which is evolutionarily important as the sister group to land plants. The chloroplast genome of Staurastrum has been fully sequenced at 157,089 base pairs, encoding 121 genes, making it substantially larger than many other chloroplast genomes despite lacking the typical rRNA-encoding inverted repeat (IR) found in many plants . This expansion is primarily due to enlarged intergenic spacers and introns compared to other streptophytes.

As a model system, S. punctulatum offers researchers insights into the evolution and functional diversity of photosynthetic apparatus across the green plant lineage, particularly the structure and function of photosystem components like CP47.

What is the functional role of CP47 chlorophyll apoprotein in Photosystem II?

CP47 is a core antenna protein of Photosystem II (PSII) encoded by the chloroplast psbB gene. Although the search results don't specifically describe CP47 in S. punctulatum, we can extrapolate its function from other photosynthetic organisms, where its role is highly conserved.

The primary functions of CP47 include:

  • Light harvesting: CP47 binds multiple chlorophyll molecules (typically 16-17 chlorophyll a molecules) that capture photons and transfer the excitation energy to the reaction center of PSII.

  • Structural organization: CP47 is essential for the proper assembly and structural stability of the PSII complex. Similar to how PsbK has been demonstrated to associate tightly with CP43 and contribute to PSII stability , CP47 plays a crucial structural role in PSII organization.

  • Energy transfer pathway: CP47 forms part of the energy transfer pathway from the peripheral light-harvesting complexes to the PSII reaction center, where charge separation occurs.

  • Oxygen evolution support: While not directly involved in the oxygen-evolving complex, CP47 helps maintain the structural environment necessary for water splitting.

Understanding CP47's function in S. punctulatum specifically would be valuable for comparative studies of photosynthetic efficiency across different algal lineages.

How is the psbB gene organized in the chloroplast genome of Staurastrum punctulatum?

The S. punctulatum chloroplast genome has several distinctive characteristics:

  • Gene organization: The chloroplast genes in S. punctulatum show substantial divergence in order compared to other charophycean algae and land plants. A minimum of 59 inversions would be required to convert the gene order of Staurastrum chloroplast DNA into that of the related alga Zygnema .

  • Coding density: Only about 51.4% of the S. punctulatum chloroplast genome consists of coding sequences, with A+T content of 65.1% in these regions .

  • Intergenic regions: These constitute approximately 42.0% of the genome with an average size of 536 bp and higher A+T content (70.0%) than coding regions .

  • Intron content: Introns make up about 6.6% of the genome with an average size of 1,298 bp and A+T content of 70.8% .

The specific arrangement of the psbB gene within this genomic context would influence its expression and regulation, particularly in response to light and other environmental factors that affect photosynthesis.

What challenges exist in expressing recombinant CP47 protein from Staurastrum punctulatum?

Producing functional recombinant CP47 from S. punctulatum presents several significant challenges that researchers must address:

  • Membrane protein expression: CP47 is an integral thylakoid membrane protein with multiple transmembrane domains. Such proteins are notoriously difficult to express in heterologous systems due to their hydrophobic nature and complex folding requirements.

  • Chlorophyll incorporation: CP47 requires proper binding of multiple chlorophyll molecules for functionality. Recombinant expression systems often lack the machinery for coordinating chlorophyll incorporation into the apoprotein structure.

  • Post-translational modifications: Although not explicitly mentioned in the search results for S. punctulatum, photosystem proteins frequently undergo post-translational modifications that affect their function. Heterologous expression systems may not replicate these modifications correctly.

  • Association with other PSII components: As observed with other photosystem components like PsbK, which is stable only when associated with CP43 in the chloroplast , CP47 likely requires interaction with other PSII components for proper folding and stability.

  • Transcriptional regulation: Light regulates translation of chloroplast proteins in photosynthetic organisms, with transcripts like psbA and rbcL being recruited into chloroplast polysomes upon illumination . Replicating these regulatory mechanisms in expression systems is challenging.

Researchers addressing these challenges might consider approaches similar to those used for studying PsbK, where antibodies against recombinant proteins were generated to study the native protein in its cellular context .

How does light regulation affect CP47 expression and assembly in Staurastrum punctulatum?

Light plays a crucial role in regulating chloroplast gene expression and protein assembly in photosynthetic organisms, including S. punctulatum. Although the search results don't specifically address CP47 regulation in this organism, we can draw insights from related studies:

  • Transcript recruitment to polysomes: Light induces recruitment of chloroplast transcripts including psbA and rbcL to polysomes, stimulating translation . A similar mechanism likely applies to psbB transcripts encoding CP47.

  • Translation elongation activation: In barley, synthesis of photosystem chlorophyll a-apoproteins is arrested on membrane-bound polysomes at the level of polypeptide chain elongation in dark-grown plants . Illumination activates translation elongation. This regulatory mechanism may be conserved in algae like S. punctulatum.

  • Coordinated protein assembly: The assembly of photosystem components is coordinated with chlorophyll synthesis, which is light-dependent. Similar to how PsbK levels correlate with CP43 levels , CP47 expression and assembly are likely coordinated with other PSII components.

  • Light-induced gene transcription: Light also influences transcript levels of photosystem genes. For example, psbA transcript levels gradually decline over extended periods without light, corresponding with senescence .

The specific light response elements in the psbB gene promoter and untranslated regions would be important determinants of how CP47 expression responds to different light intensities and qualities in S. punctulatum.

How does CP47 from Staurastrum punctulatum structurally and functionally compare to homologous proteins in other photosynthetic organisms?

Comparative analysis of CP47 across different photosynthetic lineages provides insights into both conserved functional domains and species-specific adaptations:

Organism TypeGenome FeaturesCP47 CharacteristicsEvolutionary Implications
S. punctulatum (charophycean algae)157,089 bp chloroplast genome, 121 genes No specific data available from search resultsRepresents intermediate evolutionary stage between aquatic algae and land plants
Zygnema (filamentous algae)165,372 bp chloroplast genome, 125 genes No specific data available from search resultsDistinct evolutionary path within Zygnematophyceae
Chaetosphaeridium (charophycean algae)131,183 bp chloroplast genome, 125 genes No specific data available from search resultsAnother comparative charophycean model
Land plants (e.g., Marchantia)121,024 bp chloroplast genome, 120 genes No specific data available from search resultsTerminal evolutionary outcome of streptophyte lineage

While specific structural data for S. punctulatum CP47 is not available in the search results, several comparative aspects are worth noting:

  • Gene order variation: The substantial differences in gene order between S. punctulatum and other plants suggest potential differences in gene regulation that could affect CP47 expression patterns.

  • Intron content: The relatively large introns in S. punctulatum (average 1,298 bp compared to 650 bp in Marchantia) could influence the processing of psbB transcripts.

  • Adaptation to ecological niche: S. punctulatum's preference for acidic bogs and moorland pools may have led to specific adaptations in its photosynthetic apparatus, including potential modifications to CP47 that optimize function in these environments.

Structural studies of recombinant CP47 from S. punctulatum would be valuable for understanding how this protein's architecture has evolved in response to the specific ecological and physiological constraints of this charophycean alga.

What are the optimal protocols for isolating intact Photosystem II complexes from Staurastrum punctulatum?

Isolating functional PSII complexes from S. punctulatum requires careful consideration of several methodological aspects:

  • Cell disruption: Given the distinctive cell wall structure of S. punctulatum with its coarse granules , optimization of cell disruption methods is crucial. French press or gentle sonication in the presence of appropriate buffers containing osmolytes like sorbitol or sucrose can help maintain cellular integrity until controlled lysis.

  • Thylakoid membrane isolation: Following initial disruption, differential centrifugation can separate thylakoid membranes from other cellular components. Based on protocols used for similar photosystem studies, a typical approach involves:

    • Low-speed centrifugation (1,000-3,000 × g) to remove cell debris

    • High-speed centrifugation (40,000-100,000 × g) to pellet thylakoid membranes

  • Detergent solubilization: Careful selection of detergents is critical. Based on the approach used for PsbK studies , using detergent-solubilized thylakoid membranes followed by purification of the PSII core complex would be appropriate. Mild detergents like n-dodecyl β-D-maltoside (β-DDM) or digitonin at optimized concentrations preserve PSII structural integrity.

  • Complex purification: Techniques similar to those used for PsbK localization in the PSII core complex would be applicable, including:

    • Ion exchange chromatography to separate PSII components

    • Gel filtration chromatography for further purification

    • Sucrose gradient ultracentrifugation for isolation of intact complexes

  • Verification of complex integrity: Western blotting with antibodies against various PSII components, similar to the approach used for PsbK , can confirm the presence of CP47 and assess the integrity of isolated complexes.

Maintaining low temperature (0-4°C) throughout the isolation procedure and including protease inhibitors in all buffers is essential for preserving protein integrity.

What analytical techniques are most effective for characterizing the structure and function of recombinant CP47?

Comprehensive characterization of recombinant CP47 from S. punctulatum requires multiple complementary analytical approaches:

  • Protein verification and purity assessment:

    • SDS-PAGE and immunoblotting using specific antibodies against recombinant CP47

    • Mass spectrometry for accurate mass determination and peptide mapping

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

    • Hydrogen/deuterium exchange mass spectrometry (HDX-MS) to analyze protein dynamics and conformational changes

  • Pigment analysis:

    • High-performance liquid chromatography (HPLC) to analyze bound chlorophyll molecules

    • Absorption and fluorescence spectroscopy to characterize pigment-protein interactions

    • Resonance Raman spectroscopy to probe chlorophyll-protein interactions

  • Functional analysis:

    • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics

    • Oxygen evolution measurements to assess contribution to PSII function

    • Electron paramagnetic resonance (EPR) spectroscopy to study redox properties

  • Interaction analysis:

    • Blue native PAGE to analyze intact protein complexes

    • Co-immunoprecipitation to identify protein-protein interactions

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding affinities with other PSII components

For recombinant protein specifically, additional validation should verify that the recombinant CP47 mimics the native protein's properties, particularly in terms of chlorophyll binding and structural integrity.

How can researchers assess the functional integrity of recombinant CP47 in experimental systems?

Validating that recombinant CP47 from S. punctulatum retains proper functional characteristics requires multiple complementary approaches:

  • Chlorophyll binding assessment:

    • Absorption spectroscopy to confirm characteristic chlorophyll a signatures

    • Fluorescence emission spectra to verify proper pigment-protein interactions

    • Pigment extraction and HPLC analysis to quantify chlorophyll:protein stoichiometry

  • Protein folding verification:

    • Protease protection assays to verify proper folding (properly folded proteins are generally more resistant to proteolysis)

    • Circular dichroism to confirm secondary structure elements characteristic of CP47

    • Thermal stability assays to assess protein stability

  • Assembly competence:

    • In vitro reconstitution with other PSII components to assess ability to form larger complexes

    • Co-expression with other PSII proteins to evaluate assembly in vivo

    • Pull-down assays to verify specific interactions with known binding partners

  • Energy transfer functionality:

    • Transient absorption spectroscopy to measure excitation energy transfer rates

    • Fluorescence lifetime measurements to assess energy transfer efficiency

    • Quantum yield determinations to quantify photosynthetic efficiency

  • Complementation studies:

    • Expression in CP47-deficient systems to assess functional replacement capacity

    • Reconstitution of PSII activity in CP47-depleted membrane preparations

Similar to approaches used with PsbK, where association with CP43 was assessed through co-purification and quantitative Western blotting , analyzing CP47's association with its known partners (like D1, D2, and CP43) provides valuable insights into functional integrity.

What does the comparative analysis of psbB gene reveal about photosystem evolution in the green algal lineage?

Comparative genomic analysis of the psbB gene and CP47 protein across green algal lineages provides important evolutionary insights:

This evolutionary context is crucial for interpreting functional differences in CP47 across diverse photosynthetic lineages and understanding how photosystem components co-evolved to maintain optimal energy transfer and electron transport efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.