Recombinant Stenotrophomonas maltophilia Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant YidC

YidC is a universally conserved insertase critical for integrating α-helical membrane proteins into lipid bilayers. In Stenotrophomonas maltophilia, the yidC gene (UniProt ID: B4SPG0) encodes a 571-amino-acid membrane protein insertase . Recombinant YidC is expressed as a full-length protein (1–571 aa) in E. coli, purified to >90% homogeneity, and stabilized in Tris/PBS buffer with 6% trehalose . Its applications span structural biology, enzymology, and drug discovery.

Functional Roles and Mechanisms

YidC operates through two pathways:

  1. Sec-Independent Insertion: Directly guides substrates into the membrane via its hydrophilic groove .

  2. Sec-YidC Collaboration: Partners with the Sec translocon for complex substrates .

Key functional insights:

  • Folding Chaperone: Prevents misfolding by accelerating structural segment insertion, as shown via single-molecule force spectroscopy .

  • Ribosome Interaction: Binds ribosomes at the tunnel exit to facilitate co-translational insertion .

Applications in Research

Recombinant YidC is utilized in:

  • Protein-Protein Interaction Studies: Mapping YidC’s role in Sec-dependent/independent insertion .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve insertion mechanisms .

  • Drug Development: Screening antimicrobial agents targeting bacterial membrane biogenesis .

Comparative Analysis with Other Insertases

FeatureYidCSec Translocase
MechanismInsertase/chaperone at protein-lipid interfaceTransmembrane channel with lateral opening .
Substrate Specificityα-helical membrane proteinsBroad, including secretory proteins .
Structural RequirementHydrophilic grooveMulti-subunit channel (SecYEG) .

Key Research Findings

  • In Vivo Flexibility: YidC enables MelB insertion even in SecYEG-depleted E. coli, highlighting its standalone role .

  • Misfolding Prevention: YidC rectifies misfolded regions in MelB’s pseudo-symmetric domains .

  • Co-Translational Activity: Structural models show YidC-ribosome complexes guide nascent proteins into membranes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Smlt4693; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-571
Protein Length
full length protein
Species
Stenotrophomonas maltophilia (strain K279a)
Target Names
yidC
Target Protein Sequence
MNQTRVFLIFAWLMVAVLLWMEWSREKAAPTPAPTTTSAPAAAQSVPGANPGAIPSAQVP GAPGQAAAQAQASATPASQRVTVTTDVLRLVLDGGRVLDAELLQFPQTKDEGSPPVRLLT EDPAHPYSAISGWASEDRNTPVPGADGFKLVGDTKDFVLAKGQNELQIPFVWTADNGVTI KRTLTVSRNEYAVRFKDEVSNAGAAPWNGYVYRTLDRTPTILSRSMTNPDSFSFNGATWY DNDKKYQRRAFKDYLEDGTLNQNITGGWLAMLQHHFFTAWIPQKDQTAHYVLSQVAGRDL IEARGPAFTVAPGQSTSTEARLWVGPKLVNLIAKEDVPGLDRVVDYSRFSMMAVIGQGLF WVLNQVHKLVGNWGWAIVGLVVLLKLVLYPLSATQYKSGAKMRRFQPRIAQLKERYGDDR QKFQTAMMELYKKEKINPMGGCLPILIQMPIFFALYWVLVESVELRQAPWFGWIQDLTAR DPYFILPVINVAVMWFTQKLTPAPGMDPMQQKMMQFMPLVFGVMMAFMPSGLVLYWVVNG GLGLLQQWWMTKRHGGEPVPATTAPAPVKKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in Stenotrophomonas maltophilia?

YidC is a membrane protein insertase belonging to the Oxa1 superfamily that plays an essential role in the biogenesis of the bacterial inner membrane in Stenotrophomonas maltophilia. The full-length protein (571 amino acids) contains multiple transmembrane helices and functions in two primary capacities:

  • As an independent insertase facilitating the integration of smaller membrane proteins

  • As a component that interacts with the Sec translocon to aid proper folding of multi-pass membrane proteins

YidC significantly influences the protein composition and lipid organization of the bacterial inner membrane. Structurally, YidC contains a hairpin-interrupted three-transmembrane helix (TMH) motif that is strikingly similar to the consensus proto-SecY elements, suggesting a unified evolutionary origin for these membrane protein biogenesis factors .

Methodological approach: To study YidC's basic function, researchers typically employ genetic depletion studies using arabinose-controlled expression systems (such as in E. coli strain JS7131 where yidC is under the control of the araBAD operator/promoter) , followed by analysis of membrane protein composition via proteomic methods.

What are the primary substrates of YidC in S. maltophilia?

The primary substrates of YidC in S. maltophilia include:

  • Phage coat proteins (M13 procoat and Pf3 coat proteins)

  • ATP synthase subunit c (F0c)

  • Small membrane proteins including SecG

Research has demonstrated that YidC facilitates the insertion of these substrates, which typically have one or two transmembrane segments. The hydrophobicity of the transmembrane segments appears to play an important role in YidC-dependent insertion, as evidenced by the reduced effect of YibN (a YidC interactor) on the insertion of SecG with an I20E mutation in its first transmembrane segment .

Methodological approach: Substrate identification typically involves co-expression studies where potential YidC substrates are expressed with or without YidC, followed by quantification of their membrane integration using Western blot analysis. In studies with YibN, researchers observed that "the synthesis of PC-Lep, Pf3-23Lep, and F0c was significantly increased in the presence of YibN," suggesting that YibN enhances YidC-mediated insertion .

What methods are most effective for expressing and purifying recombinant S. maltophilia YidC?

Effective expression and purification of recombinant S. maltophilia YidC typically involves:

  • Expression system: E. coli is the preferred expression host, with the recombinant protein typically fused to an N-terminal His-tag for purification purposes .

  • Expression conditions:

    • Expression vector with inducible promoter (such as T7 or arabinose-inducible promoters)

    • Growth at temperatures below 37°C (often 25-30°C) to improve proper folding

    • Induction at optimal optical density (typically OD600 of 0.4-0.6)

  • Purification protocol:

    • Membrane fraction isolation using ultracentrifugation

    • Solubilization with mild detergents (DDM is commonly used)

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography for further purification

  • Storage considerations:

    • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Aliquoting and storage at -20°C/-80°C

    • Addition of 5-50% glycerol to prevent freeze-thaw damage

According to product specifications: "We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃."

Methodological approach: Optimization of expression conditions often requires testing multiple parameters, including different E. coli strains (BL21(DE3), C41(DE3), C43(DE3)), induction temperatures, and detergent screening for optimal solubilization.

How do YidC interactions with other proteins affect membrane protein biogenesis?

YidC interacts with several proteins to facilitate membrane protein biogenesis, with YibN being a particularly important interaction partner:

  • YidC-YibN interaction:

    • YibN has been identified as a crucial component within the YidC protein environment through proximity-dependent biotin labeling (BioID)

    • This interaction has been confirmed through affinity purification-mass spectrometry assays on native membranes and on-gel binding assays with purified proteins

    • SILAC-labeling experiments demonstrated >20-fold enrichment of YibN with His-tagged YidC and >50-fold enrichment of YidC with His-tagged YibN compared to background

  • Functional consequences of YidC-YibN interaction:

    • Enhanced production and membrane insertion of YidC substrates

    • Stimulation of membrane lipid production

    • Promotion of inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity

  • YidC-Sec translocon interaction:

    • YidC cooperates with the Sec translocon for the insertion of more complex membrane proteins

    • This interaction aids in the proper folding of multi-pass membrane proteins

Methodological approach: Protein-protein interactions are typically studied using pull-down assays, co-immunoprecipitation, FRET, and crosslinking experiments. The YidC-YibN interaction was revealed through affinity purification followed by mass spectrometry, with validation through reciprocal experiments and native expression conditions .

What phenotypic changes occur upon YidC depletion in bacteria?

YidC depletion leads to several significant phenotypic changes in bacteria:

  • Growth defects:

    • Reduced growth rate

    • Smaller colony size

    • Eventual cell death, indicating the essential nature of YidC

  • Membrane protein composition alterations:

    • Decreased levels of respiratory chain complexes

    • Impaired ATP synthase assembly and activity

    • Defects in the biogenesis of various membrane proteins

  • Physiological consequences:

    • Disruption of proton motive force (PMF)

    • Compromised membrane integrity

    • Altered lipid organization

Methodological approach: To study YidC depletion effects, researchers typically use strains where YidC expression is under the control of an inducible promoter (like the araBAD promoter in E. coli strain JS7131). Cells are grown in the presence of the inducer (arabinose) and then shifted to media lacking the inducer (or containing glucose as a repressor). Physiological parameters are then monitored over time, as described in the literature:

"E. coli strain JS7131, in which yidC is under the control of the araBAD operator/promoter, was grown overnight at 37°C in LB medium supplemented with 0.2% L-arabinose. Cells were harvested, washed with warm LB, diluted to an OD660 of 0.05, and further grown with 0.1% glucose to deplete YidC or with 0.1% L-arabinose to generate nondepleted control cells."

What experimental approaches can elucidate the conformational dynamics of YidC during substrate insertion?

Understanding the conformational dynamics of YidC during substrate insertion requires sophisticated experimental approaches:

  • Molecular dynamics simulations:

    • Equilibrium simulations to assess native dynamics

    • Non-equilibrium targeted molecular dynamics (TMD) to model substrate movement

    • Analysis of root mean square deviation (RMSD) to quantify conformational changes

  • Site-directed spin labeling and electron paramagnetic resonance (EPR):

    • Strategically placed spin labels to monitor local conformational changes

    • Continuous wave EPR for mobility analysis

    • Pulsed EPR for distance measurements between specific residues

  • Single-molecule FRET:

    • Fluorescent labeling of YidC and substrates at key positions

    • Real-time monitoring of distance changes during insertion

    • Analysis of FRET efficiency changes to detect conformational states

  • Cryo-electron microscopy:

    • Capture of different insertion intermediates through rapid freezing

    • Classification of particles to identify different conformational states

    • 3D reconstruction of YidC with partially inserted substrates

Recent computational analyses have shown that "YidC protein fluctuated more in pose 1 than in pose 2" during simulations of Pf3 coat protein insertion, with an RMSD in pose 1 approximately 2 Å greater than in pose 2, suggesting "YidC goes through significant conformational changes at the start of the process."

Methodological approach: A comprehensive study would combine multiple techniques. For example, researchers have used "equilibrium and non-equilibrium MD simulations" with "RMSD collective variable" in TMD simulations to transfer the Pf3 coat protein from the initial binding position to the periplasmic side of the membrane .

How does S. maltophilia YidC contribute to antibiotic resistance mechanisms?

S. maltophilia is an emerging multidrug-resistant global opportunistic pathogen, and YidC may contribute to antibiotic resistance through several mechanisms:

  • Membrane protein biogenesis role:

    • YidC facilitates the insertion of membrane proteins that may include efflux pumps

    • S. maltophilia harbors numerous resistance-nodulation-division (RND) efflux pumps that contribute to multidrug resistance

    • Proper assembly of these efflux systems likely depends on YidC function

  • Membrane integrity and permeability:

    • YidC affects membrane composition and organization

    • These changes may alter membrane permeability to antibiotics

    • The lipid scramblase activity of YidC could influence outer membrane asymmetry

  • Potential interactions with resistance determinants:

    • YidC may affect the assembly of other resistance-conferring membrane proteins

    • The interaction between YidC and YibN has been shown to promote membrane proliferation , which could potentially dilute antibiotic concentration

S. maltophilia employs numerous resistance mechanisms, including:

  • Nine RND-type efflux pump genes in clinical isolate K279a

  • L1 and L2 β-lactamases

  • Low membrane permeability

Methodological approach: Investigating YidC's role in antibiotic resistance would involve creating conditional YidC depletion strains and measuring changes in minimum inhibitory concentrations (MICs) for various antibiotics, as well as analyzing the membrane proteome to detect alterations in efflux pump assembly and integration.

What therapeutic strategies might target YidC to combat S. maltophilia infections?

Given YidC's essential role in membrane protein biogenesis, several therapeutic strategies could potentially target this protein:

  • Direct inhibition of YidC function:

    • Small molecule inhibitors targeting the hydrophilic groove

    • Peptide-based inhibitors mimicking YidC substrates

    • Compounds that lock YidC in non-functional conformations

  • Disruption of YidC-protein interactions:

    • Compounds targeting the YidC-YibN interface, given the enhancement of YidC function by YibN

    • Peptides disrupting YidC interaction with the Sec translocon

    • Inhibitors of specific YidC-substrate interactions

  • Immunological approaches:

    • Antibodies targeting exposed epitopes of YidC

    • Vaccine development using recombinant YidC domains

    • The outer membrane protein approach used for Smlt4123 could serve as a model

  • Combination therapies:

    • YidC inhibitors with conventional antibiotics

    • Targeting YidC in combination with efflux pump inhibitors

    • Dual targeting of YidC and other essential membrane processes

Methodological approach: High-throughput screening of compound libraries against purified YidC or YidC-expressing bacterial cells, followed by structural and functional characterization of hits. Additionally, immunization studies could follow protocols similar to those used for Smlt4123:

"Recombinant Omps were prepared and used to immunize mice, and the potency of mouse anti-Omp serum was tested in opsonophagocytic killing assay (OPKA). The effects of immunization with recombinant Omp on blood and tissue bacterial loads in a mouse model of S. maltophilia-induced infection were analyzed."

How do the structural features of S. maltophilia YidC compare with YidC homologs from other bacteria?

Comparative analysis of S. maltophilia YidC with homologs from other bacteria reveals important structural and functional insights:

  • Conserved core structure:

    • The hairpin-interrupted three-TMH motif is a defining feature of YidC across bacterial species

    • This motif is strikingly similar to consensus proto-SecY elements, suggesting evolutionary relationships

    • Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY

  • Species-specific variations:

    • S. maltophilia YidC contains 571 amino acids, which may differ in length from homologs in other species

    • Variations in the periplasmic and cytoplasmic domains likely reflect species-specific interactions

    • The hydrophilic groove may show variations in size and charge distribution

  • Functional conservation:

    • Despite structural variations, the core function as a membrane protein insertase is conserved

    • The dual role in independent insertion and Sec-dependent folding appears to be a common feature

    • The lipid scramblase activity may vary between species

Methodological approach: Comparative analysis typically involves sequence alignment, homology modeling, and phylogenetic analysis. Functional conservation can be assessed through complementation studies, where S. maltophilia YidC is expressed in another species with depleted native YidC to determine if it can rescue the phenotype.

What is the role of YidC in S. maltophilia pathogenesis and virulence?

While direct evidence for YidC's role in S. maltophilia pathogenesis is limited, several aspects suggest its potential importance:

  • Membrane protein biogenesis:

    • YidC facilitates the insertion of membrane proteins that may include virulence factors

    • S. maltophilia virulence factors include proteases, lytic enzymes, and biofilm components

    • Proper assembly of secretion systems and adhesins likely depends on YidC function

  • Stress response and adaptation:

    • YidC may contribute to S. maltophilia's ability to adapt to host environments

    • Proper assembly of stress response proteins could enhance survival during infection

    • YidC's role in membrane integrity may help resist host defense mechanisms

  • Potential connection to quorum sensing:

    • S. maltophilia pathogenesis is governed by a quorum sensing molecule called diffusible signaling factor (DSF)

    • DSF regulates biofilm formation, synthesis of extracellular polymeric substance, and secretion of protease

    • YidC may be involved in the insertion of proteins required for DSF production or sensing

S. maltophilia causes various infections in humans, particularly serious lung infections in individuals with cystic fibrosis, with high mortality rates . The bacterium employs various virulence factors, including "lytic enzymes and serine proteases, that cause acute infection in host organisms" and "establishes chronic infections through biofilm formation" .

Methodological approach: Investigation of YidC's role in pathogenesis would involve creating conditional YidC depletion strains and testing them in infection models, as well as analyzing the membrane proteome to detect alterations in virulence factor assembly and secretion.

What are the optimal storage and handling conditions for recombinant S. maltophilia YidC?

Proper storage and handling of recombinant S. maltophilia YidC is critical for maintaining its structural integrity and functional activity:

  • Storage conditions:

    • Temperature: Store at -20°C/-80°C upon receipt

    • Buffer composition: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

    • Additives: Addition of 5-50% glycerol (final concentration) is recommended

    • Aliquoting: Distribute into small working aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For short-term use, store working aliquots at 4°C for up to one week

  • Quality control parameters:

    • Purity: Greater than 90% as determined by SDS-PAGE

    • Activity: Functional assays should be performed after reconstitution

    • Stability: Avoid repeated freeze-thaw cycles

According to commercial specifications: "Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week."

Methodological approach: Before experimental use, researchers should verify protein integrity by SDS-PAGE and potentially circular dichroism to ensure proper folding, especially after reconstitution.

What biophysical methods are most appropriate for studying YidC-substrate interactions?

Several biophysical methods are particularly well-suited for studying YidC-substrate interactions:

  • Surface plasmon resonance (SPR):

    • Direct measurement of binding kinetics and affinity

    • Can detect interactions with membrane protein substrates

    • Allows real-time monitoring of association and dissociation

  • Isothermal titration calorimetry (ITC):

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG) of the interaction

    • No labeling required

    • Can be performed with detergent-solubilized or reconstituted YidC

  • Microscale thermophoresis (MST):

    • Measures binding in solution with minimal sample consumption

    • Works well with membrane proteins in detergent micelles

    • Requires minimal modification of interaction partners

  • Förster resonance energy transfer (FRET):

    • Can detect proximity between YidC and substrates

    • Allows monitoring of dynamic interaction processes

    • Particularly useful for tracking insertion intermediates

  • Crosslinking coupled with mass spectrometry:

    • Identifies specific contact sites between YidC and substrates

    • Can capture transient interactions during the insertion process

    • Provides structural information about the interaction interface

Methodological approach: A comprehensive study would employ multiple complementary techniques. For example, researchers have used a combination of proximity-dependent biotin labeling (BioID), affinity purification-mass spectrometry, and on-gel binding assays to characterize the interaction between YidC and YibN .

What emerging technologies might advance our understanding of YidC function?

Several emerging technologies hold promise for advancing our understanding of YidC function:

  • Cryo-electron tomography:

    • Visualization of YidC in its native membrane environment

    • Capturing structural details during actual insertion events

    • Potential to observe YidC-Sec translocon interactions in situ

  • Single-molecule tracking in live cells:

    • Real-time monitoring of YidC dynamics in bacterial membranes

    • Capturing the kinetics of substrate interaction and insertion

    • Determining the spatial organization of YidC in the membrane

  • Deep mutational scanning:

    • Comprehensive mapping of structure-function relationships

    • Identification of critical residues for substrate recognition and insertion

    • Discovery of mutations that alter substrate specificity

  • AlphaFold and other AI-based structural prediction tools:

    • Accurate prediction of YidC structures from different species

    • Modeling of YidC-substrate complexes

    • Prediction of conformational changes during the insertion cycle

  • Proximity-dependent labeling techniques:

    • Comprehensive mapping of the YidC interactome

    • Identification of novel interaction partners and substrates

    • Temporal dynamics of YidC associations during membrane protein biogenesis

Methodological approach: Combining these emerging technologies with established methods will provide a more complete picture of YidC function. For example, cryo-electron tomography of cells expressing fluorescently tagged YidC could allow correlation of structural features with dynamic behavior observed in live-cell imaging.

How might YidC research contribute to novel antimicrobial strategies?

Research on S. maltophilia YidC holds significant potential for developing novel antimicrobial strategies:

  • Direct targeting strategies:

    • Identification of small molecules that specifically inhibit YidC function

    • Design of peptidomimetics that interfere with YidC-substrate interactions

    • Development of compounds that disrupt YidC oligomerization

  • Combination approaches:

    • YidC inhibitors could sensitize S. maltophilia to existing antibiotics

    • Targeting both YidC and efflux pumps could overcome intrinsic resistance

    • Combination with membrane-disrupting agents might show synergy

  • Immunological strategies:

    • YidC-based vaccine development for high-risk populations

    • Antibodies targeting accessible epitopes of YidC

    • Immunomodulatory approaches enhancing host clearance of S. maltophilia

  • Novel screening platforms:

    • High-throughput assays based on YidC function

    • Virtual screening targeting YidC structural features

    • Phenotypic screens for compounds that mimic YidC depletion

The increasing resistance of S. maltophilia to multiple antibiotics, including trimethoprim/sulfamethoxazole , creates an urgent need for novel therapeutic approaches. Given YidC's essential role, it represents a promising target that has not yet been exploited clinically.

Methodological approach: Development of high-throughput screening assays that monitor YidC-dependent membrane protein insertion, followed by medicinal chemistry optimization of identified hits and in vivo efficacy testing in animal models of S. maltophilia infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.