Recombinant Stenotrophomonas maltophilia NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Stenotrophomonas maltophilia NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Stenotrophomonas maltophilia NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the bacterial species S. maltophilia, a Gram-negative, multidrug-resistant pathogen implicated in nosocomial and opportunistic infections . The nuoK protein is a component of NADH dehydrogenase (Complex I), a key enzyme in bacterial electron transport chains that facilitates energy production via proton translocation . Recombinant nuoK is produced in heterologous systems (e.g., E. coli or baculovirus) for structural, functional, and diagnostic research applications.

Production and Characterization of Recombinant nuoK

Recombinant nuoK is typically expressed with affinity tags (e.g., N-terminal His-tag) to enable purification via chromatography . Below are key technical specifications and variations across commercial preparations:

ParameterDetailsSource
Gene/Protein IDnuoK (UniProt: B4SQS6 or B2FN96, depending on strain)
Expression SystemE. coli (common) or baculovirus (partial-length constructs)
Protein LengthFull-length (1–101aa) or partial, depending on construct design
Purity>90% (SDS-PAGE) or >85% (partial constructs)
Storage BufferTris/PBS-based with 6% trehalose or 50% glycerol, pH 8.0
ReconstitutionSterile water or glycerol-containing solutions for long-term storage

Amino Acid Sequence
A representative sequence from strain R551-3:
MITLGHMLALGAVLFAISLAGIFLNRKNVIVLLMSIELMLLSVNVNFVAFSRQLGDPSGQLFVFFILTVAAAEAAIGLAILVTLFRTRRTINVGEVDSLKG . Variations exist between strains (e.g., K279a) .

Diagnostic ELISA Development

Recombinant nuoK serves as an antigen in enzyme-linked immunosorbent assays (ELISA) for detecting anti-S. maltophilia antibodies, aiding in serological research .

Vaccine Candidate Research

Though not directly reported, subunit vaccines targeting virulence factors like nuoK could theoretically disrupt bacterial metabolism or immune evasion .

Research Gaps and Future Directions

  1. Structural Characterization: High-resolution crystallography or cryo-EM studies of nuoK to elucidate its role in Complex I assembly.

  2. Pathogenicity Links: Investigating whether nuoK expression correlates with S. maltophilia’s ability to adapt to host environments or resist stress.

  3. Therapeutic Targeting: Exploring small-molecule inhibitors of nuoK as adjunct therapies for multidrug-resistant infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Smlt3395; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Stenotrophomonas maltophilia (strain K279a)
Target Names
nuoK
Target Protein Sequence
MITLGHMLALGAVLFAISLAGIFLNRKNVIVLLMSIELMLLSVNINFVGFSRQLGDPSGQ LFVFFILTVAAAEAAIGLAILVTLFRTRRTINVGEVDSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Stenotrophomonas maltophilia and why is it significant in research?

Stenotrophomonas maltophilia is a ubiquitous, gram-negative, biofilm-forming bacterium that has emerged as a multidrug-resistant opportunistic pathogen in both hospital and community settings. It is characterized as an aerobic, non-fermentative, motile bacillus with polar flagella, catalase-positive, and oxidase-negative properties. The bacterium is slightly smaller (0.7–1.8 × 0.4–0.7 μm) than most other members of the genus . Despite being primarily aerobic, S. maltophilia can grow using nitrate as a terminal electron acceptor in the absence of oxygen .

S. maltophilia has gained significant research interest for several reasons:

  • It is increasingly recognized as a nosocomial pathogen, particularly in immunocompromised patients, with mortality rates up to 37.5% .

  • The prevalence of S. maltophilia infection has increased from 0.8–1.4% (1997–2003) to 1.3–1.68% (2007–2012) .

  • It demonstrates remarkable multidrug resistance capabilities through various mechanisms including β-lactamase production, expression of Qnr genes, class 1 integrons, and multiple efflux pumps .

  • The bacterium has been classified by the World Health Organization as one of the leading multidrug-resistant organisms in hospital settings .

For researchers, S. maltophilia provides a model system for studying bacterial adaptation, antimicrobial resistance mechanisms, and energy metabolism pathways, including the function of the NADH-quinone oxidoreductase complex.

What is the NADH-quinone oxidoreductase (NDH-1) complex and what role does it play in bacterial energy metabolism?

The NADH-quinone oxidoreductase (NDH-1) is a bacterial H⁺-translocating complex that catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane . This complex represents the bacterial counterpart of mitochondrial Complex I and plays several critical roles:

  • Energy conservation: NDH-1 couples the transfer of electrons from NADH to quinone with the translocation of protons across the membrane, contributing to the proton motive force used for ATP synthesis.

  • Redox balancing: It reoxidizes NADH produced during metabolic processes, maintaining cellular redox homeostasis.

  • Respiratory flexibility: The complex contributes to the bacterium's ability to adapt to different environmental conditions.

In S. maltophilia, NDH-1 is particularly important for energy metabolism and may contribute to the organism's environmental adaptability, allowing it to thrive in diverse habitats ranging from plant rhizospheres to hospital environments .

What is the basic structure and composition of the NuoK subunit in S. maltophilia?

The NuoK subunit of S. maltophilia NDH-1 is a counterpart of the mitochondrial ND4L subunit and represents one of the seven hydrophobic subunits in the membrane domain of the complex . The key structural features of NuoK include:

  • Three transmembrane segments (TM1-3) that anchor the protein within the bacterial cytoplasmic membrane .

  • Two conserved glutamic acid residues located in adjacent transmembrane helices that are critical for energy-coupled activity: (K)Glu-36 in TM2 and (K)Glu-72 in TM3 .

  • A short cytoplasmic loop between TM1 and TM2 (loop-1) containing key residues including (K)Arg-25, (K)Arg-26, and (K)Asn-27 .

The NuoK subunit, despite its relatively small size, plays a crucial role in the energy-transducing mechanism of NDH-1, particularly through its conserved charged residues that may participate in proton translocation pathways.

What conserved residues in NuoK are critical for function and how have they been identified?

Research has identified several conserved residues in the NuoK subunit that are essential for its function in energy transduction. The identification and characterization of these residues have primarily been accomplished through site-directed mutagenesis and functional assays:

  • (K)Glu-36 in TM2: This highly conserved carboxyl residue is critical for NDH-1 activity. Mutation of this residue to alanine leads to complete loss of NDH-1 activities, indicating its essential role in energy transduction .

  • (K)Glu-72 in TM3: This second conserved carboxyl residue moderately reduces NDH-1 activities when mutated, suggesting a supportive but not essential role in energy coupling .

  • Arginine residues in loop-1: Two arginine residues ((K)Arg-25 and (K)Arg-26) located in the short cytoplasmic loop between TM1 and TM2 have been shown to dramatically affect energy transducing activities when mutated together .

  • (K)Asn-27: This residue in loop-1 has also been identified as important for the energy transducing activities of NDH-1 .

These functionally critical residues have been identified through systematic mutagenesis studies where researchers created specific amino acid substitutions and then assessed the resulting impact on enzyme activity and energy coupling.

How do mutations in the conserved glutamic acid residues of NuoK affect NDH-1 function?

The impact of mutations in the conserved glutamic acid residues of NuoK on NDH-1 function has been extensively studied, revealing their differential contributions to energy transduction:

  • Mutation of (K)Glu-36 (TM2):

    • Substitution to alanine completely abolishes NDH-1 activities

    • This demonstrates the essential nature of this residue for the energy coupling mechanism

  • Mutation of (K)Glu-72 (TM3):

    • Substitution results in only moderate reduction of NDH-1 activities

    • Suggests a supportive rather than central role in energy transduction

  • Positional effects of (K)Glu-36 relocation:

    • When (K)Glu-36 was shifted along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy transducing NDH-1 activities

    • These positions are located in the vicinity of the original position, present in the same helix phase, immediately before and after a helix turn

    • This suggests some flexibility in the precise position of this carboxyl residue, as long as it remains in the same spatial region of the protein

These findings indicate that the carboxyl residues in NuoK likely participate in proton translocation pathways, with (K)Glu-36 playing a more critical role than (K)Glu-72 in the mechanism of energy coupling.

What is the significance of the cytosolic loop between TM1 and TM2 in NuoK?

The short cytosolic loop between the first two transmembrane segments of NuoK (loop-1) has been identified as critically important for the energy transducing activities of NDH-1 . This region contains several key residues that contribute to function:

  • Positively charged residues: (K)Arg-25 and (K)Arg-26 are arginine residues located in this loop that have a dramatic effect on energy transduction when mutated together .

  • Polar residue: (K)Asn-27 is also located in this loop and contributes to the protein's function .

The significance of this loop likely stems from:

  • Its location at the cytoplasmic interface, potentially allowing it to interact with other subunits or with the aqueous environment

  • The charged and polar nature of its key residues, which may play roles in proton transfer or in maintaining proper protein conformation

  • Its potential involvement in conformational changes during the catalytic cycle

The importance of this cytosolic loop suggests that it may serve as more than just a connector between transmembrane segments, potentially playing an active role in the mechanism of energy transduction.

How can site-directed mutagenesis be optimized to study NuoK function?

Site-directed mutagenesis is a powerful approach for studying the function of specific amino acid residues in NuoK. Based on existing research, an optimized strategy would include:

Experimental Design Framework:

  • Target residue selection:

    • Prioritize highly conserved residues identified through sequence alignment across species

    • Focus on charged residues (Glu, Asp, Arg, Lys) which often participate in proton transfer

    • Consider residues in transmembrane regions and at interfaces between protein domains

  • Mutation strategy:

    • Conservative substitutions (e.g., Glu→Asp) to test the importance of side chain length

    • Non-conservative substitutions (e.g., Glu→Ala) to completely eliminate functional groups

    • Positional scanning: moving key residues along transmembrane helices to test spatial requirements

  • Expression system considerations:

    • Use homologous expression in S. maltophilia for native protein processing

    • Alternative: E. coli-based expression with appropriate detergents for membrane protein solubilization

    • Consider inducible promoters to control expression levels

  • Functional assays:

    • NADH:quinone oxidoreductase activity measurements using artificial electron acceptors

    • Proton translocation assays using pH-sensitive dyes or electrodes

    • Membrane potential measurements using voltage-sensitive probes

  • Structural integrity verification:

    • Western blotting to confirm proper expression

    • Blue native PAGE to assess complex assembly

    • Limited proteolysis to verify folding

This approach has been successfully employed to identify critical residues like (K)Glu-36 and (K)Glu-72, and to examine the effects of relocating these residues within transmembrane segments .

What techniques are most effective for measuring the activity of recombinant NuoK in the context of the NDH-1 complex?

Measuring the activity of recombinant NuoK within the NDH-1 complex requires specialized techniques that assess both electron transfer and proton pumping capabilities:

Electron Transfer Activity Measurements:

  • NADH oxidation assays:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Use of artificial electron acceptors such as ferricyanide or ubiquinone analogues

    • Calculation of specific activity (μmol NADH oxidized/min/mg protein)

  • Quinone reduction assays:

    • Measurement of ubiquinone or menaquinone reduction

    • Use of radiolabeled substrates or fluorescent quinone analogs

Proton Pumping Measurements:

  • pH change detection:

    • Use of pH-sensitive dyes like ACMA (9-amino-6-chloro-2-methoxyacridine)

    • pH electrode measurements in reconstituted proteoliposomes

  • Membrane potential assays:

    • Fluorescent probes like Rhodamine 123 or DiSC3(5)

    • Potentiometric measurements with TPP+ (tetraphenylphosphonium)

Integrated Structure-Function Analysis:

  • Reconstitution systems:

    • Incorporation of purified NDH-1 complexes into liposomes

    • Co-reconstitution with ATP synthase to measure coupled ATP synthesis

  • Whole-cell assays:

    • Oxygen consumption measurements

    • Determination of proton motive force in intact cells

These techniques allow researchers to determine how specific mutations, such as those in the conserved glutamic acid residues of NuoK, affect both the electron transfer activity and the proton translocation efficiency of the NDH-1 complex.

How can researchers effectively express and purify recombinant S. maltophilia NuoK for functional studies?

Expressing and purifying recombinant membrane proteins like S. maltophilia NuoK presents significant challenges. Based on research approaches with similar proteins, an effective protocol would include:

Expression Strategies:

  • Expression systems:

    • E. coli C41(DE3) or C43(DE3) strains, specifically designed for membrane protein expression

    • S. maltophilia-based expression system for native folding environment

    • Cell-free expression systems for difficult-to-express proteins

  • Vector design:

    • Inducible promoters (T7, trc, or arabinose-inducible)

    • Fusion tags: His6, Strep-tag II, or MBP for improved folding and purification

    • Cleavable tags with TEV or PreScission protease sites

  • Expression conditions:

    • Low temperature induction (16-20°C)

    • Reduced inducer concentration

    • Extended expression time (24-48 hours)

    • Supplementation with extra nitrogen sources for optimal growth

Purification Protocol:

  • Membrane preparation:

    • Cell disruption by sonication or French press

    • Differential centrifugation to isolate membrane fraction

    • Washing steps to remove peripheral proteins

  • Solubilization:

    • Mild detergents: n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG

    • Detergent screening to optimize solubilization efficiency

    • Addition of phospholipids to stabilize the protein

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography to remove aggregates

    • Optional: ion exchange chromatography for higher purity

  • Quality control:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure assessment

    • Activity assays to confirm functional integrity

This methodical approach addresses the challenges inherent in membrane protein purification and provides a framework for obtaining functional NuoK protein suitable for structure-function studies.

How does the NuoK subunit contribute to the proton pumping mechanism of NDH-1?

The contribution of NuoK to the proton pumping mechanism of NDH-1 involves several critical elements based on structure-function studies:

Key Mechanisms of NuoK Involvement:

  • Conserved charged residues form proton pathway:

    • (K)Glu-36 in TM2 is essential for energy transduction, likely serving as a proton donor/acceptor in the translocation pathway

    • (K)Glu-72 in TM3 plays a supporting role in proton transfer

    • The positioning of these residues in adjacent transmembrane helices creates a potential proton transfer route

  • Transmembrane helix orientation:

    • The relative positioning of TM2 and TM3, which contain the critical glutamic acid residues, is likely important for forming a functional proton channel

    • Relocating (K)Glu-36 to positions 32, 38, 39, and 40 maintains function, suggesting some positional flexibility within the same helical face

  • Cytoplasmic loop contribution:

    • The loop between TM1 and TM2 contains positively charged arginine residues ((K)Arg-25 and (K)Arg-26) that significantly impact energy transduction

    • These residues may facilitate proton uptake from the cytoplasmic side or mediate conformational changes necessary for proton pumping

  • Conformational coupling:

    • NuoK likely undergoes conformational changes in response to electron transfer events in other parts of the complex

    • These conformational changes may alter the pKa values of key residues, facilitating directional proton movement

What structural and functional differences exist between S. maltophilia NuoK and its homologs in other bacterial species?

The structural and functional characteristics of S. maltophilia NuoK can be compared with homologous proteins in other bacterial species to understand evolutionary conservation and specialization:

Comparative Analysis Table: NuoK/ND4L Across Species

While the search results don't provide explicit comparative data for S. maltophilia NuoK versus other species, general patterns in NDH-1/Complex I research suggest:

  • Core structure conservation:

    • The three transmembrane helix arrangement is likely conserved across species

    • The positions of key charged residues in transmembrane segments show high evolutionary conservation

  • Species-specific adaptations:

    • Thermophilic bacteria may have additional stabilizing interactions

    • Environmental adaptations in S. maltophilia may reflect its ability to thrive in diverse conditions

    • Variations in loop regions may exist to accommodate species-specific interaction partners

  • Functional conservation:

    • The fundamental role in proton pumping is likely conserved

    • The essential nature of the conserved glutamic acid residue equivalent to (K)Glu-36 is probably maintained across species

These comparisons provide context for understanding the broader significance of findings from S. maltophilia NuoK studies and their potential applicability to homologous proteins in other organisms.

How does the genomic context of nuoK in S. maltophilia influence its expression and function?

The genomic context of nuoK in S. maltophilia provides important insights into its regulation, expression, and functional integration within the NDH-1 complex:

Genomic Organization and Expression Regulation:

While the search results don't provide specific information about the genomic organization of nuoK in S. maltophilia, we can infer likely arrangements based on related bacteria:

  • Operon structure:

    • The nuoK gene is typically part of the nuo operon containing all NDH-1 subunit genes

    • This arrangement ensures coordinated expression of all components

  • Genome analysis insights:

    • S. maltophilia has several sequenced strains including K279a, R551-3, and AU12-09

    • K279a genome is 4,851,126 bp with high G+C content

    • The genome reveals remarkable capacity for drug and heavy metal resistance

  • Environmental strain variations:

    • Environmental strain BurA1 shows absence of certain RND pumps (SmeABC) but presence of others (EbyCAB) acquired via horizontal gene transfer

    • Such genomic plasticity may extend to variations in energy metabolism genes including nuoK

  • Transcriptomic approaches:

    • Comparative genomics and transcriptomics have identified significant differences between MDR S. maltophilia and non-pathogenic plant-associated strains

    • These approaches could reveal differential expression patterns of nuoK under various conditions

  • Regulatory elements:

    • Typical bacterial promoters and regulatory elements likely control nuoK expression

    • Expression may be coordinated with other energy metabolism genes

The genomic context of nuoK is important for understanding its coordinated expression with other NDH-1 subunits and potential strain-specific variations that might influence the function of the complex in different S. maltophilia isolates adapted to specific environmental niches.

How can research on S. maltophilia NuoK contribute to understanding and addressing antimicrobial resistance?

Research on S. maltophilia NuoK has significant potential to contribute to understanding and combating antimicrobial resistance through several avenues:

  • Energy metabolism as a drug target:

    • The bacterial respiratory chain, including NDH-1, represents an underexploited target for antimicrobial development

    • Inhibitors targeting NuoK or its interactions could disrupt energy production in S. maltophilia

    • Understanding the unique features of S. maltophilia NuoK could allow for selective targeting

  • Antibiotic resistance connections:

    • Energy-dependent efflux pumps are major contributors to S. maltophilia's multidrug resistance

    • NDH-1 function may indirectly support antibiotic resistance by providing energy for these efflux systems

    • RND-type efflux pumps like SmeABC, SmeDEF, SmeIJK, SmeOP, SmeVWX, and SmeYZ require proton motive force generated in part by NDH-1

  • Phylogenetic comparisons:

    • Comparing NuoK structure and function across bacterial species could reveal adaptations specific to pathogens

    • Understanding evolutionary conservation of NuoK could identify universally essential features as broad-spectrum targets

  • Biofilm connections:

    • S. maltophilia is characterized by its ability to form biofilms on various surfaces, including lung cells

    • Energy metabolism is critical for biofilm formation and maintenance

    • NuoK function may indirectly influence biofilm-associated antibiotic resistance

  • Stress response mechanisms:

    • Energy production via NDH-1 is linked to bacterial adaptation to environmental stresses

    • Understanding how S. maltophilia modulates energy metabolism during antibiotic exposure could reveal resistance mechanisms

By deepening our understanding of this critical component of bacterial energy metabolism, research on NuoK could ultimately contribute to developing novel therapeutic approaches against this increasingly important multidrug-resistant pathogen.

What cutting-edge techniques could advance our understanding of NuoK structure and function?

Advancing our understanding of NuoK structure and function requires application of cutting-edge techniques that can overcome the challenges associated with membrane protein research:

Emerging Methodologies for NuoK Research:

These advanced techniques could provide unprecedented insights into the structure, dynamics, and function of NuoK, potentially revealing new therapeutic targets and deepening our understanding of bacterial energy transduction mechanisms.

What are common challenges in expressing and purifying functional recombinant NuoK and how can they be addressed?

Researchers working with recombinant NuoK face several common challenges inherent to membrane protein research. Here are the major issues and potential solutions:

Expression Challenges:

  • Protein toxicity:

    • Problem: Overexpression of membrane proteins can disrupt host cell membranes

    • Solution: Use tightly regulated expression systems with low basal expression; consider cell-free expression systems

  • Inclusion body formation:

    • Problem: Misfolded NuoK may accumulate in inclusion bodies

    • Solution: Lower expression temperature (16-20°C); reduce inducer concentration; use specialized strains like C41(DE3)

  • Low expression levels:

    • Problem: Membrane proteins often express at low yields

    • Solution: Optimize codon usage; test different fusion tags (MBP, SUMO); screen multiple expression conditions

Purification Challenges:

  • Detergent selection:

    • Problem: Inappropriate detergents may destabilize the protein

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin); consider detergent mixtures; add stabilizing lipids

  • Protein instability:

    • Problem: NuoK may denature during purification

    • Solution: Maintain low temperature throughout; add glycerol (10-20%); include protease inhibitors

  • Loss of function:

    • Problem: Purified protein may lose activity

    • Solution: Validate function at each purification step; reconstitute into liposomes promptly

Functional Analysis Challenges:

  • Complex assembly:

    • Problem: Isolated NuoK may not function without other NDH-1 subunits

    • Solution: Co-express with interacting partners; purify intact NDH-1 complex

  • Activity measurement:

    • Problem: Difficulty in assessing NuoK-specific contributions to activity

    • Solution: Compare wild-type with site-directed mutants; use complementation assays in knockout strains

Troubleshooting Table for NuoK Expression and Purification:

ChallengeSymptomsPotential CausesSolutions
Low expressionWeak band on Western blotToxicity, poor transcriptionLower temperature, optimize codons, try different host strains
AggregationProtein in pellet after centrifugationImproper folding, inadequate solubilizationScreen detergents, add stabilizing agents, optimize buffer conditions
Loss of activityReduced enzyme activityDenaturation during purificationMinimize purification steps, maintain cold temperature, add stabilizers
Poor purityMultiple bands on SDS-PAGENon-specific binding to affinity resinAdd imidazole in wash buffers, use tandem purification, optimize salt concentration
DegradationLower MW bands on Western blotProtease activityAdd protease inhibitors, reduce purification time, keep samples cold

By systematically addressing these challenges, researchers can improve their chances of successfully working with recombinant S. maltophilia NuoK.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.