Recombinant Stenotrophomonas maltophilia NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the bacterial species S. maltophilia, a Gram-negative, multidrug-resistant pathogen implicated in nosocomial and opportunistic infections . The nuoK protein is a component of NADH dehydrogenase (Complex I), a key enzyme in bacterial electron transport chains that facilitates energy production via proton translocation . Recombinant nuoK is produced in heterologous systems (e.g., E. coli or baculovirus) for structural, functional, and diagnostic research applications.
Recombinant nuoK is typically expressed with affinity tags (e.g., N-terminal His-tag) to enable purification via chromatography . Below are key technical specifications and variations across commercial preparations:
Amino Acid Sequence
A representative sequence from strain R551-3:
MITLGHMLALGAVLFAISLAGIFLNRKNVIVLLMSIELMLLSVNVNFVAFSRQLGDPSGQLFVFFILTVAAAEAAIGLAILVTLFRTRRTINVGEVDSLKG . Variations exist between strains (e.g., K279a) .
Recombinant nuoK serves as an antigen in enzyme-linked immunosorbent assays (ELISA) for detecting anti-S. maltophilia antibodies, aiding in serological research .
Though not directly reported, subunit vaccines targeting virulence factors like nuoK could theoretically disrupt bacterial metabolism or immune evasion .
Structural Characterization: High-resolution crystallography or cryo-EM studies of nuoK to elucidate its role in Complex I assembly.
Pathogenicity Links: Investigating whether nuoK expression correlates with S. maltophilia’s ability to adapt to host environments or resist stress.
Therapeutic Targeting: Exploring small-molecule inhibitors of nuoK as adjunct therapies for multidrug-resistant infections .
KEGG: sml:Smlt3395
STRING: 522373.Smlt3395
Stenotrophomonas maltophilia is a ubiquitous, gram-negative, biofilm-forming bacterium that has emerged as a multidrug-resistant opportunistic pathogen in both hospital and community settings. It is characterized as an aerobic, non-fermentative, motile bacillus with polar flagella, catalase-positive, and oxidase-negative properties. The bacterium is slightly smaller (0.7–1.8 × 0.4–0.7 μm) than most other members of the genus . Despite being primarily aerobic, S. maltophilia can grow using nitrate as a terminal electron acceptor in the absence of oxygen .
S. maltophilia has gained significant research interest for several reasons:
It is increasingly recognized as a nosocomial pathogen, particularly in immunocompromised patients, with mortality rates up to 37.5% .
The prevalence of S. maltophilia infection has increased from 0.8–1.4% (1997–2003) to 1.3–1.68% (2007–2012) .
It demonstrates remarkable multidrug resistance capabilities through various mechanisms including β-lactamase production, expression of Qnr genes, class 1 integrons, and multiple efflux pumps .
The bacterium has been classified by the World Health Organization as one of the leading multidrug-resistant organisms in hospital settings .
For researchers, S. maltophilia provides a model system for studying bacterial adaptation, antimicrobial resistance mechanisms, and energy metabolism pathways, including the function of the NADH-quinone oxidoreductase complex.
The NADH-quinone oxidoreductase (NDH-1) is a bacterial H⁺-translocating complex that catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane . This complex represents the bacterial counterpart of mitochondrial Complex I and plays several critical roles:
Energy conservation: NDH-1 couples the transfer of electrons from NADH to quinone with the translocation of protons across the membrane, contributing to the proton motive force used for ATP synthesis.
Redox balancing: It reoxidizes NADH produced during metabolic processes, maintaining cellular redox homeostasis.
Respiratory flexibility: The complex contributes to the bacterium's ability to adapt to different environmental conditions.
In S. maltophilia, NDH-1 is particularly important for energy metabolism and may contribute to the organism's environmental adaptability, allowing it to thrive in diverse habitats ranging from plant rhizospheres to hospital environments .
The NuoK subunit of S. maltophilia NDH-1 is a counterpart of the mitochondrial ND4L subunit and represents one of the seven hydrophobic subunits in the membrane domain of the complex . The key structural features of NuoK include:
Three transmembrane segments (TM1-3) that anchor the protein within the bacterial cytoplasmic membrane .
Two conserved glutamic acid residues located in adjacent transmembrane helices that are critical for energy-coupled activity: (K)Glu-36 in TM2 and (K)Glu-72 in TM3 .
A short cytoplasmic loop between TM1 and TM2 (loop-1) containing key residues including (K)Arg-25, (K)Arg-26, and (K)Asn-27 .
The NuoK subunit, despite its relatively small size, plays a crucial role in the energy-transducing mechanism of NDH-1, particularly through its conserved charged residues that may participate in proton translocation pathways.
Research has identified several conserved residues in the NuoK subunit that are essential for its function in energy transduction. The identification and characterization of these residues have primarily been accomplished through site-directed mutagenesis and functional assays:
(K)Glu-36 in TM2: This highly conserved carboxyl residue is critical for NDH-1 activity. Mutation of this residue to alanine leads to complete loss of NDH-1 activities, indicating its essential role in energy transduction .
(K)Glu-72 in TM3: This second conserved carboxyl residue moderately reduces NDH-1 activities when mutated, suggesting a supportive but not essential role in energy coupling .
Arginine residues in loop-1: Two arginine residues ((K)Arg-25 and (K)Arg-26) located in the short cytoplasmic loop between TM1 and TM2 have been shown to dramatically affect energy transducing activities when mutated together .
(K)Asn-27: This residue in loop-1 has also been identified as important for the energy transducing activities of NDH-1 .
These functionally critical residues have been identified through systematic mutagenesis studies where researchers created specific amino acid substitutions and then assessed the resulting impact on enzyme activity and energy coupling.
The impact of mutations in the conserved glutamic acid residues of NuoK on NDH-1 function has been extensively studied, revealing their differential contributions to energy transduction:
Mutation of (K)Glu-36 (TM2):
Mutation of (K)Glu-72 (TM3):
Positional effects of (K)Glu-36 relocation:
When (K)Glu-36 was shifted along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy transducing NDH-1 activities
These positions are located in the vicinity of the original position, present in the same helix phase, immediately before and after a helix turn
This suggests some flexibility in the precise position of this carboxyl residue, as long as it remains in the same spatial region of the protein
These findings indicate that the carboxyl residues in NuoK likely participate in proton translocation pathways, with (K)Glu-36 playing a more critical role than (K)Glu-72 in the mechanism of energy coupling.
The short cytosolic loop between the first two transmembrane segments of NuoK (loop-1) has been identified as critically important for the energy transducing activities of NDH-1 . This region contains several key residues that contribute to function:
Positively charged residues: (K)Arg-25 and (K)Arg-26 are arginine residues located in this loop that have a dramatic effect on energy transduction when mutated together .
Polar residue: (K)Asn-27 is also located in this loop and contributes to the protein's function .
The significance of this loop likely stems from:
Its location at the cytoplasmic interface, potentially allowing it to interact with other subunits or with the aqueous environment
The charged and polar nature of its key residues, which may play roles in proton transfer or in maintaining proper protein conformation
Its potential involvement in conformational changes during the catalytic cycle
The importance of this cytosolic loop suggests that it may serve as more than just a connector between transmembrane segments, potentially playing an active role in the mechanism of energy transduction.
Site-directed mutagenesis is a powerful approach for studying the function of specific amino acid residues in NuoK. Based on existing research, an optimized strategy would include:
Experimental Design Framework:
Target residue selection:
Prioritize highly conserved residues identified through sequence alignment across species
Focus on charged residues (Glu, Asp, Arg, Lys) which often participate in proton transfer
Consider residues in transmembrane regions and at interfaces between protein domains
Mutation strategy:
Expression system considerations:
Use homologous expression in S. maltophilia for native protein processing
Alternative: E. coli-based expression with appropriate detergents for membrane protein solubilization
Consider inducible promoters to control expression levels
Functional assays:
NADH:quinone oxidoreductase activity measurements using artificial electron acceptors
Proton translocation assays using pH-sensitive dyes or electrodes
Membrane potential measurements using voltage-sensitive probes
Structural integrity verification:
Western blotting to confirm proper expression
Blue native PAGE to assess complex assembly
Limited proteolysis to verify folding
This approach has been successfully employed to identify critical residues like (K)Glu-36 and (K)Glu-72, and to examine the effects of relocating these residues within transmembrane segments .
Measuring the activity of recombinant NuoK within the NDH-1 complex requires specialized techniques that assess both electron transfer and proton pumping capabilities:
Electron Transfer Activity Measurements:
NADH oxidation assays:
Spectrophotometric monitoring of NADH oxidation at 340 nm
Use of artificial electron acceptors such as ferricyanide or ubiquinone analogues
Calculation of specific activity (μmol NADH oxidized/min/mg protein)
Quinone reduction assays:
Measurement of ubiquinone or menaquinone reduction
Use of radiolabeled substrates or fluorescent quinone analogs
Proton Pumping Measurements:
pH change detection:
Use of pH-sensitive dyes like ACMA (9-amino-6-chloro-2-methoxyacridine)
pH electrode measurements in reconstituted proteoliposomes
Membrane potential assays:
Fluorescent probes like Rhodamine 123 or DiSC3(5)
Potentiometric measurements with TPP+ (tetraphenylphosphonium)
Integrated Structure-Function Analysis:
Reconstitution systems:
Incorporation of purified NDH-1 complexes into liposomes
Co-reconstitution with ATP synthase to measure coupled ATP synthesis
Whole-cell assays:
Oxygen consumption measurements
Determination of proton motive force in intact cells
These techniques allow researchers to determine how specific mutations, such as those in the conserved glutamic acid residues of NuoK, affect both the electron transfer activity and the proton translocation efficiency of the NDH-1 complex.
Expressing and purifying recombinant membrane proteins like S. maltophilia NuoK presents significant challenges. Based on research approaches with similar proteins, an effective protocol would include:
Expression Strategies:
Expression systems:
E. coli C41(DE3) or C43(DE3) strains, specifically designed for membrane protein expression
S. maltophilia-based expression system for native folding environment
Cell-free expression systems for difficult-to-express proteins
Vector design:
Inducible promoters (T7, trc, or arabinose-inducible)
Fusion tags: His6, Strep-tag II, or MBP for improved folding and purification
Cleavable tags with TEV or PreScission protease sites
Expression conditions:
Low temperature induction (16-20°C)
Reduced inducer concentration
Extended expression time (24-48 hours)
Supplementation with extra nitrogen sources for optimal growth
Purification Protocol:
Membrane preparation:
Cell disruption by sonication or French press
Differential centrifugation to isolate membrane fraction
Washing steps to remove peripheral proteins
Solubilization:
Mild detergents: n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG
Detergent screening to optimize solubilization efficiency
Addition of phospholipids to stabilize the protein
Purification steps:
Immobilized metal affinity chromatography (IMAC)
Size exclusion chromatography to remove aggregates
Optional: ion exchange chromatography for higher purity
Quality control:
SDS-PAGE and Western blotting
Mass spectrometry for identity confirmation
Circular dichroism for secondary structure assessment
Activity assays to confirm functional integrity
This methodical approach addresses the challenges inherent in membrane protein purification and provides a framework for obtaining functional NuoK protein suitable for structure-function studies.
The contribution of NuoK to the proton pumping mechanism of NDH-1 involves several critical elements based on structure-function studies:
Key Mechanisms of NuoK Involvement:
Conserved charged residues form proton pathway:
Transmembrane helix orientation:
Cytoplasmic loop contribution:
Conformational coupling:
NuoK likely undergoes conformational changes in response to electron transfer events in other parts of the complex
These conformational changes may alter the pKa values of key residues, facilitating directional proton movement
The structural and functional characteristics of S. maltophilia NuoK can be compared with homologous proteins in other bacterial species to understand evolutionary conservation and specialization:
While the search results don't provide explicit comparative data for S. maltophilia NuoK versus other species, general patterns in NDH-1/Complex I research suggest:
Core structure conservation:
The three transmembrane helix arrangement is likely conserved across species
The positions of key charged residues in transmembrane segments show high evolutionary conservation
Species-specific adaptations:
Thermophilic bacteria may have additional stabilizing interactions
Environmental adaptations in S. maltophilia may reflect its ability to thrive in diverse conditions
Variations in loop regions may exist to accommodate species-specific interaction partners
Functional conservation:
The fundamental role in proton pumping is likely conserved
The essential nature of the conserved glutamic acid residue equivalent to (K)Glu-36 is probably maintained across species
These comparisons provide context for understanding the broader significance of findings from S. maltophilia NuoK studies and their potential applicability to homologous proteins in other organisms.
The genomic context of nuoK in S. maltophilia provides important insights into its regulation, expression, and functional integration within the NDH-1 complex:
Genomic Organization and Expression Regulation:
While the search results don't provide specific information about the genomic organization of nuoK in S. maltophilia, we can infer likely arrangements based on related bacteria:
Operon structure:
The nuoK gene is typically part of the nuo operon containing all NDH-1 subunit genes
This arrangement ensures coordinated expression of all components
Genome analysis insights:
Environmental strain variations:
Transcriptomic approaches:
Regulatory elements:
Typical bacterial promoters and regulatory elements likely control nuoK expression
Expression may be coordinated with other energy metabolism genes
The genomic context of nuoK is important for understanding its coordinated expression with other NDH-1 subunits and potential strain-specific variations that might influence the function of the complex in different S. maltophilia isolates adapted to specific environmental niches.
Research on S. maltophilia NuoK has significant potential to contribute to understanding and combating antimicrobial resistance through several avenues:
Energy metabolism as a drug target:
The bacterial respiratory chain, including NDH-1, represents an underexploited target for antimicrobial development
Inhibitors targeting NuoK or its interactions could disrupt energy production in S. maltophilia
Understanding the unique features of S. maltophilia NuoK could allow for selective targeting
Antibiotic resistance connections:
Energy-dependent efflux pumps are major contributors to S. maltophilia's multidrug resistance
NDH-1 function may indirectly support antibiotic resistance by providing energy for these efflux systems
RND-type efflux pumps like SmeABC, SmeDEF, SmeIJK, SmeOP, SmeVWX, and SmeYZ require proton motive force generated in part by NDH-1
Phylogenetic comparisons:
Comparing NuoK structure and function across bacterial species could reveal adaptations specific to pathogens
Understanding evolutionary conservation of NuoK could identify universally essential features as broad-spectrum targets
Biofilm connections:
Stress response mechanisms:
Energy production via NDH-1 is linked to bacterial adaptation to environmental stresses
Understanding how S. maltophilia modulates energy metabolism during antibiotic exposure could reveal resistance mechanisms
By deepening our understanding of this critical component of bacterial energy metabolism, research on NuoK could ultimately contribute to developing novel therapeutic approaches against this increasingly important multidrug-resistant pathogen.
Advancing our understanding of NuoK structure and function requires application of cutting-edge techniques that can overcome the challenges associated with membrane protein research:
Emerging Methodologies for NuoK Research:
These advanced techniques could provide unprecedented insights into the structure, dynamics, and function of NuoK, potentially revealing new therapeutic targets and deepening our understanding of bacterial energy transduction mechanisms.
Researchers working with recombinant NuoK face several common challenges inherent to membrane protein research. Here are the major issues and potential solutions:
Expression Challenges:
Protein toxicity:
Problem: Overexpression of membrane proteins can disrupt host cell membranes
Solution: Use tightly regulated expression systems with low basal expression; consider cell-free expression systems
Inclusion body formation:
Problem: Misfolded NuoK may accumulate in inclusion bodies
Solution: Lower expression temperature (16-20°C); reduce inducer concentration; use specialized strains like C41(DE3)
Low expression levels:
Problem: Membrane proteins often express at low yields
Solution: Optimize codon usage; test different fusion tags (MBP, SUMO); screen multiple expression conditions
Purification Challenges:
Detergent selection:
Problem: Inappropriate detergents may destabilize the protein
Solution: Screen multiple detergents (DDM, LMNG, digitonin); consider detergent mixtures; add stabilizing lipids
Protein instability:
Problem: NuoK may denature during purification
Solution: Maintain low temperature throughout; add glycerol (10-20%); include protease inhibitors
Loss of function:
Problem: Purified protein may lose activity
Solution: Validate function at each purification step; reconstitute into liposomes promptly
Functional Analysis Challenges:
Complex assembly:
Problem: Isolated NuoK may not function without other NDH-1 subunits
Solution: Co-express with interacting partners; purify intact NDH-1 complex
Activity measurement:
Problem: Difficulty in assessing NuoK-specific contributions to activity
Solution: Compare wild-type with site-directed mutants; use complementation assays in knockout strains
Troubleshooting Table for NuoK Expression and Purification:
| Challenge | Symptoms | Potential Causes | Solutions |
|---|---|---|---|
| Low expression | Weak band on Western blot | Toxicity, poor transcription | Lower temperature, optimize codons, try different host strains |
| Aggregation | Protein in pellet after centrifugation | Improper folding, inadequate solubilization | Screen detergents, add stabilizing agents, optimize buffer conditions |
| Loss of activity | Reduced enzyme activity | Denaturation during purification | Minimize purification steps, maintain cold temperature, add stabilizers |
| Poor purity | Multiple bands on SDS-PAGE | Non-specific binding to affinity resin | Add imidazole in wash buffers, use tandem purification, optimize salt concentration |
| Degradation | Lower MW bands on Western blot | Protease activity | Add protease inhibitors, reduce purification time, keep samples cold |
By systematically addressing these challenges, researchers can improve their chances of successfully working with recombinant S. maltophilia NuoK.