Recombinant Stenotrophomonas maltophilia Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
htpX; Smlt3323; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Stenotrophomonas maltophilia (strain K279a)
Target Names
htpX
Target Protein Sequence
MLTRIALFLATNFAVLILASIVMSLLGVNPSQMSGLLVMAAIFGFGGSFISLLLSKWMAK RSTGAVVITEPRNQTERWLLATVERQAKAAGIGMPEVAVYEGPEINAFATGANRNNALVA VSTGLLHNMSEDEAEAVLGHEIAHVANGDMITMALLQGVLNTFVIVLARVVGGIIDSALS GNREGGGRGFAYYIIVFVLEMVFGLFATMISMWFSRHREFRADAGGASLAGRQKMIAALE RLQLNHGQSTLPTQIAAFGIAGSTAKKLFMSHPPLEERIAALRASTVA
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its role in Stenotrophomonas maltophilia?

HtpX is a metalloprotease that plays a crucial role in intrinsic aminoglycoside resistance in Stenotrophomonas maltophilia. It belongs to the protease-chaperone system that helps the bacterium respond to antibiotic stress. Specifically, HtpX functions as a protease that is significantly upregulated when the bacterium is exposed to aminoglycosides such as kanamycin, indicating its involvement in stress response mechanisms. The protein contains an M48 peptidase domain that is essential for its proteolytic activity and contributes to the bacterium's ability to survive in the presence of aminoglycoside antibiotics .

How is the htpX gene regulated in S. maltophilia?

The htpX gene expression in S. maltophilia is directly upregulated in response to aminoglycoside exposure, particularly kanamycin. Research has shown that alongside other protease and chaperone genes such as clpA, clpS, and clpP, htpX expression increases when the bacterium encounters aminoglycosides. This upregulation is part of a coordinated stress response mechanism that helps the bacterium adapt to antibiotic pressure. The regulation appears to be independent of the SmeYZ efflux pump system, as studies have shown that smeZ transcript levels remain comparable in both wild-type and htpX-deletion mutants regardless of kanamycin presence .

What is the relationship between HtpX and aminoglycoside resistance?

HtpX serves as a primary determinant responsible for intrinsic aminoglycoside resistance in S. maltophilia. Experimental evidence demonstrates that inactivation of htpX significantly compromises protease-mediated intrinsic aminoglycoside resistance. Furthermore, deletion of htpX weakens SmeYZ pump-mediated aminoglycoside resistance, despite not affecting the expression level of the SmeYZ pump itself. This suggests that HtpX contributes to aminoglycoside resistance through mechanisms that enhance or complement the function of efflux pumps, potentially by assisting in the proper folding or stability of resistance-related proteins. Due to this critical role, HtpX has been identified as a potential aminoglycoside adjuvant target for treatment of S. maltophilia infections .

What are the established methods for cloning and expressing recombinant htpX?

Cloning and expressing recombinant htpX involves several key steps:

  • Primer Design: Design primers containing appropriate restriction enzyme recognition sites (e.g., BamHI and SmaI) based on the htpX gene sequence. For example, primers used for amplifying htpX from Priestia megaterium DX-3 were:

    • Forward primer: 5′-CGGATCCTGCTGCTAAAACATTCACTGTT-3′

    • Reverse primer: 5′-TCCCCGGGTTTATAGGAATGCAAGCGC-3′

  • PCR Amplification: Use genomic DNA as a template to amplify the htpX gene using PCR.

  • Vector Construction: Digest the PCR product and expression vector (e.g., pHT43) with appropriate restriction enzymes, then ligate to create the recombinant plasmid.

  • Transformation: Transform the recombinant plasmid first into E. coli DH5α for validation through bacterial PCR and sequencing, then into expression hosts such as E. coli BL21(DE3) or Bacillus subtilis WB800N.

  • Expression Induction: Culture the engineered strain to appropriate density (OD600 ≈ 0.6–0.8) and induce protein expression using IPTG (typically at 1 mM final concentration).

  • Protein Recovery and Analysis: Centrifuge the culture, collect the fermentation supernatant, and analyze using SDS-PAGE electrophoresis and enzymatic activity assays .

How can researchers effectively analyze HtpX function through gene deletion studies?

Analyzing HtpX function through gene deletion studies involves a systematic approach:

  • Construction of Deletion Mutants: Prepare recombinant plasmids containing upstream and downstream regions of the htpX gene with the gene itself partially deleted. This requires amplifying two PCR fragments flanking the htpX gene and cloning them into a suitable vector (e.g., pEX18Tc).

  • Gene Deletion Confirmation: After plasmid mobilization and transconjugant selection, confirm the deletion mutant through PCR and sequencing.

  • Phenotypic Analysis:

    • Conduct susceptibility tests to determine the impact of htpX deletion on aminoglycoside resistance

    • Compare MIC (Minimum Inhibitory Concentration) values between wild-type and deletion mutants

    • Create combination deletion mutants (e.g., htpX with clpA or smeYZ) to study interactions between different resistance mechanisms

  • Gene Expression Analysis: Use qRT-PCR to measure expression levels of related genes in both wild-type and deletion mutants, with and without antibiotic stress.

  • Complementation Tests: Reintroduce the intact htpX gene into the deletion mutant to confirm that observed phenotypic changes are directly attributable to the absence of htpX .

What approaches are recommended for structural characterization of HtpX protease?

Structural characterization of HtpX protease can be accomplished through several complementary approaches:

How does HtpX interact with other proteases and efflux pumps in conferring aminoglycoside resistance?

The relationship between HtpX, other proteases, and efflux pumps in S. maltophilia reveals complex interactions in aminoglycoside resistance:

  • Coordinated Protease System: HtpX functions alongside other proteases and chaperones, particularly ClpA, in establishing intrinsic aminoglycoside resistance. When both clpA and htpX are inactivated simultaneously, S. maltophilia shows significantly increased susceptibility to aminoglycosides compared to single gene deletions, suggesting complementary roles .

  • Interaction with SmeYZ Efflux Pump: While the SmeYZ efflux pump is a key determinant for aminoglycoside resistance in S. maltophilia, its relationship with HtpX is not straightforward:

    • The expression level of the smeYZ operon remains similar in both wild-type and htpX/clpA deletion mutants

    • Despite normal smeYZ expression in htpX/clpA deletion mutants, the SmeYZ pump contributes little to aminoglycoside resistance in these mutants

    • The triple mutant (ΔsmeYZ/ΔclpA/ΔhtpX) shows similar aminoglycoside susceptibility to the double mutant (ΔclpA/ΔhtpX)

This indicates that HtpX and ClpA may be necessary for proper functioning of the SmeYZ pump, potentially through post-translational modifications or by affecting the assembly or stability of the pump components, rather than through transcriptional regulation.

What is the significance of HtpX as a target for novel therapeutic approaches?

HtpX represents a promising target for developing novel therapeutic approaches against S. maltophilia infections for several reasons:

  • Aminoglycoside Adjuvant Potential: Inactivation of htpX significantly increases bacterial susceptibility to aminoglycosides, suggesting that HtpX inhibitors could serve as adjuvants to restore or enhance aminoglycoside efficacy against resistant S. maltophilia strains.

  • Dual Targeting Strategy: HtpX inhibition not only compromises protease-mediated intrinsic aminoglycoside resistance but also weakens SmeYZ pump-mediated resistance. This dual effect makes it particularly valuable as a therapeutic target.

  • Conservation Among Resistant Strains: As a contributor to intrinsic resistance, HtpX is likely conserved across clinical isolates of S. maltophilia, potentially offering a broadly applicable target.

  • Addressing Multirug Resistance: S. maltophilia is increasingly recognized as a multidrug-resistant (MDR) bacterium associated with respiratory infections, particularly in patients with cystic fibrosis and other underlying pathologies. Given the intrinsic resistance of this pathogen to many antibiotics, targeting HtpX could provide a novel approach to overcome this clinical challenge .

  • Targeted Inhibitor Design: The availability of structural information about HtpX, including its M48 peptidase domain and active site configuration, provides a foundation for structure-based design of specific inhibitors .

How does the M48 peptidase domain contribute to HtpX function?

The M48 peptidase domain is a defining feature of HtpX that directly contributes to its function through several mechanisms:

  • Catalytic Activity: As a metalloprotease, the M48 domain contains the catalytic machinery necessary for peptide bond hydrolysis, including metal-binding sites that coordinate essential metal ions (typically zinc) required for catalysis.

  • Substrate Recognition: The domain structure forms a substrate-binding pocket that determines the specificity of HtpX for particular protein substrates, likely including proteins involved in antibiotic resistance mechanisms.

  • Metal Ion Binding: Studies on recombinant HtpX have shown that calcium ion (Ca²⁺) binding to the protease results in the formation of the largest active pocket, suggesting that metal ions play a crucial role in modulating the enzyme's activity and substrate specificity .

  • Stress Response Functionality: The M48 domain enables HtpX to participate in protein quality control under stress conditions, such as those induced by aminoglycoside exposure, by degrading misfolded or damaged proteins that could otherwise be toxic to the cell.

  • Conservation: The M48 peptidase domain is conserved among HtpX homologs across bacterial species, indicating its fundamental importance to bacterial physiology and stress responses.

What are common challenges in recombinant expression of HtpX and how can they be addressed?

Researchers working with recombinant HtpX may encounter several challenges:

  • Low Expression Levels: HtpX, being a membrane-associated protease, may express poorly in conventional systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and test multiple expression hosts (E. coli BL21(DE3), Bacillus subtilis WB800N) to identify optimal systems .

  • Protein Insolubility: Membrane-associated proteases often form inclusion bodies.

    • Solution: Express as fusion proteins with solubility tags, optimize growth temperature (typically lower temperatures reduce inclusion body formation), or develop refolding protocols from inclusion bodies.

  • Autoproteolysis: Active proteases may degrade themselves during expression.

    • Solution: Express as inactive zymogens or with mutations in the active site that can later be reversed, use protease inhibitors during purification, or employ rapid purification protocols at reduced temperatures.

  • Host Toxicity: Overexpression of active proteases may be toxic to the host.

    • Solution: Use tightly controlled inducible expression systems, express in protease-deficient strains like B. subtilis WB800N, or use secretion systems to direct the protease out of the cytoplasm.

  • Preserving Activity During Purification: Maintaining enzymatic activity throughout purification can be challenging.

    • Solution: Include appropriate metal ions (Ca²⁺, Zn²⁺) in buffers, avoid chelating agents like EDTA, and optimize buffer conditions (pH, salt concentration) based on enzyme characterization .

How can researchers effectively compare HtpX function across different bacterial species?

Comparing HtpX function across different bacterial species requires a multifaceted approach:

  • Sequence Alignment and Phylogenetic Analysis:

    • Perform multiple sequence alignments of htpX genes and their protein products from different species

    • Construct phylogenetic trees to understand evolutionary relationships

    • Identify conserved domains and species-specific variations

  • Heterologous Expression Systems:

    • Express htpX genes from different species in the same host organism

    • Use standardized expression vectors, induction conditions, and activity assays

    • Compare expression levels, solubility, and enzymatic activities quantitatively

  • Complementation Studies:

    • Introduce htpX genes from different species into htpX-deletion mutants

    • Assess the degree to which foreign htpX genes can restore wild-type phenotypes

    • Measure specific parameters such as aminoglycoside resistance profiles

  • Structure-Function Analysis:

    • Compare predicted or solved protein structures

    • Identify variations in active sites and substrate-binding regions

    • Correlate structural differences with functional variations

  • Standardized Phenotypic Assays:

    • Develop consistent methodologies for measuring aminoglycoside resistance

    • Use identical growth conditions and antibiotic concentrations

    • Create a standardized panel of aminoglycosides for testing across species

  • Transcriptomic and Proteomic Context:

    • Compare the regulatory networks controlling htpX expression

    • Identify species-specific interacting partners

    • Map the position of htpX within stress response pathways in different organisms

What methodological considerations are important when measuring HtpX activity?

Accurate measurement of HtpX proteolytic activity requires careful attention to several methodological factors:

  • Substrate Selection:

    • Choose substrates that reflect the physiological targets of HtpX

    • Consider both synthetic peptides and full-length proteins for comprehensive characterization

    • Include appropriate controls to ensure specificity

  • Assay Conditions:

    • Optimize pH, temperature, and ionic strength conditions

    • Include essential metal ions (particularly Ca²⁺ and Zn²⁺) at appropriate concentrations

    • Control for potential interfering substances in the reaction mixture

  • Detection Methods:

    • Fluorogenic or chromogenic substrates for continuous monitoring

    • SDS-PAGE analysis for visualization of substrate degradation

    • Mass spectrometry for identification of cleavage sites and specificity

  • Data Analysis:

    • Conduct experiments in triplicate and report results as mean ± standard deviation

    • Use appropriate software (e.g., Origin 2021) for generating graphs and statistical analysis

    • Calculate kinetic parameters (Km, kcat) to quantitatively compare different conditions or mutants

  • Inhibitor Studies:

    • Include class-specific protease inhibitors to confirm the metalloprotease nature of HtpX

    • Test potential aminoglycoside adjuvants for their ability to inhibit HtpX activity

    • Establish dose-response relationships for promising inhibitors

  • Correlation with In Vivo Function:

    • Develop assays that can correlate in vitro proteolytic activity with in vivo aminoglycoside resistance

    • Compare wild-type and mutant enzymes using standardized activity measurements

    • Relate enzymatic activity to minimum inhibitory concentrations (MICs) of aminoglycosides

How might high-throughput experimentation advance HtpX research?

High-throughput experimentation (HTE) offers significant potential for advancing HtpX research through:

  • Inhibitor Discovery: HTE approaches can enable screening of large compound libraries to identify potential HtpX inhibitors that could serve as aminoglycoside adjuvants. This would involve miniaturized assays in 96, 384, or even 1536-well plate formats to maximize efficiency while minimizing reagent consumption .

  • Substrate Specificity Profiling: Using peptide libraries or proteome-wide approaches to systematically identify the preferred substrates of HtpX, providing insights into its physiological functions and potential roles beyond aminoglycoside resistance.

  • Mutational Analysis: Creating and testing libraries of HtpX variants with systematic mutations across the protein sequence to identify critical residues for catalysis, substrate binding, and metal ion coordination.

  • Condition Optimization: Rapidly testing multiple conditions (pH, temperature, metal ions, buffer components) to identify optimal environments for HtpX activity, stability, and inhibition.

  • Combination Studies: Evaluating HtpX inhibitors in combination with various aminoglycosides across multiple S. maltophilia strains to identify synergistic combinations and strain-specific effects .

What is the potential role of HtpX in cross-resistance to other antimicrobial agents?

Beyond aminoglycosides, HtpX may contribute to broader antimicrobial resistance in S. maltophilia:

  • Cross-Resistance Patterns: Research on S. maltophilia has demonstrated that resistance to one antimicrobial agent can confer cross-resistance to other classes of antibiotics. The role of HtpX in this phenomenon deserves investigation, particularly whether HtpX-mediated mechanisms contribute to resistance against other antibiotic classes beyond aminoglycosides .

  • Antimicrobial Peptide Resistance: S. maltophilia can develop resistance to antimicrobial peptides (AMPs) through various mechanisms. Given that HtpX is a protease, it may potentially degrade or modify AMPs, contributing to resistance against these alternative antimicrobial agents .

  • Stress Response Integration: As a component of the bacterial stress response system, HtpX likely participates in generalized adaptation mechanisms that help bacteria survive various antimicrobial challenges, not just aminoglycosides.

  • Biofilm Formation: Many proteases influence biofilm formation and maintenance, which is a key resistance mechanism against multiple antibiotic classes. The potential role of HtpX in biofilm-associated resistance represents an important area for future investigation.

  • Evolutionary Considerations: Understanding how HtpX function has evolved in response to different selective pressures may provide insights into its broader role in antimicrobial resistance and potential for targeting in combination therapies.

How do HtpX proteases from different bacterial species compare in structure and function?

Comparative analysis of HtpX across bacterial species reveals important insights:

  • Structural Conservation: While the M48 peptidase domain is generally conserved across species, variations in other regions may influence substrate specificity, regulation, and interaction with other cellular components.

  • Functional Specialization: In S. maltophilia, HtpX is notably involved in aminoglycoside resistance, but in other bacteria, its primary functions may differ. For example, in some species, it may be more involved in general stress response or protein quality control rather than specific antibiotic resistance.

  • Taxonomic Distribution: Understanding the distribution and conservation of HtpX across bacterial taxa can provide evolutionary insights and help identify species where HtpX inhibition might be a particularly effective therapeutic strategy.

  • Species-Specific Interactions: The interaction partners and regulatory networks controlling HtpX likely vary between species, influencing its functional roles and potential as a therapeutic target.

  • Environmental Adaptation: HtpX may have evolved different substrate preferences or regulatory mechanisms in bacteria adapted to different ecological niches, reflecting the specific challenges encountered in those environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.