Recombinant Stenotrophomonas maltophilia Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

uppP operates within the cell wall synthesis pathway by recycling UPP, a carrier lipid required for:

  • Peptidoglycan assembly: Transports sugar precursors across the cytoplasmic membrane .

  • Bacitracin resistance: Bacitracin inhibits UPP recycling by binding UPP; uppP activity counteracts this by hydrolyzing UPP to UP .

The enzyme’s active site residues and structural motifs are conserved across Gram-negative bacteria, underscoring its essential role in cell viability .

Antibiotic Resistance Studies

uppP is a biomarker for bacitracin resistance. Recombinant forms enable:

  • Mechanistic studies: Elucidating how UPP hydrolysis bypasses bacitracin inhibition .

  • Drug discovery: High-throughput screening for uppP inhibitors to potentiate bacitracin efficacy .

Technical Notes

  • Reconstitution: Lyophilized uppP is reconstituted in sterile water or PBS with glycerol for long-term stability .

  • Activity assays: Colorimetric or radiometric methods detect phosphate release from UPP substrates .

Challenges and Future Directions

While recombinant uppP is critical for studying cell wall biosynthesis, challenges include:

  • Species-specific variability: Activity and structure differ slightly between bacterial species, complicating broad-spectrum applications .

  • Therapeutic targeting: Inhibitor design must avoid off-target effects on human phosphatases.

Current research focuses on engineering uppP variants with enhanced stability for industrial enzymology and structure-guided drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Smlt0150; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Stenotrophomonas maltophilia (strain K279a)
Target Names
uppP
Target Protein Sequence
MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNIVIQAGAIVAVVLVFRQ RLLQLATGFNQRGNREYVFKLGAAFLVTAVVGLVVRKAGWSLPETVSPVAWALIIGGVWM LLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRSASAIFLAMLLGLSRRAAAAE FVFLVGIPTMFAASAYTFLEMAKAGQLGSEDWADVGVAFLAAAITGFVVVKWLMGYIKSH RFTAFAIYRIALGAALLLWLPSGS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Stenotrophomonas maltophilia UppP and what is its primary function?

Stenotrophomonas maltophilia Undecaprenyl-diphosphatase (UppP) is a bacterial membrane phosphatase that plays a critical role in cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to form undecaprenyl phosphate (C55-P) . This enzymatic conversion is essential for the recycling of the lipid carrier that transports peptidoglycan precursors across the bacterial membrane. The enzyme specifically cleaves the terminal phosphate group from C55-PP without further processing the C55-P product into undecaprenol, demonstrating its high substrate specificity .

As a membrane-associated enzyme, UppP contributes to the structural integrity of the bacterial cell wall, making it potentially essential for bacterial survival and virulence. The enzyme's activity can be monitored in real-time using mass spectrometry, which reveals the gradual decrease in UppP-bound C55-PP and corresponding increase in C55-P product throughout the reaction time course .

How does S. maltophilia UppP relate to antimicrobial resistance mechanisms?

S. maltophilia is recognized as an emerging global multiple-drug-resistant organism with challenging treatment options . UppP's role in cell wall biosynthesis makes it a potential target for antimicrobial agents. Interestingly, UppP activity can be inhibited by the antibiotic bacitracin, which competes with the enzyme for binding to C55-PP . This mechanism highlights the potential of UppP as a target for developing novel therapeutic approaches against this multidrug-resistant pathogen.

Research suggests an inverse relationship between antibiotic resistance and biofilm formation capabilities in S. maltophilia strains . Since cell wall components contribute to biofilm structure, UppP's function may indirectly influence this relationship, though direct evidence linking UppP to biofilm formation is currently limited.

What are the characteristic structural features of UppP's catalytic site?

The catalytic site of S. maltophilia UppP contains several conserved amino acid residues that are essential for its enzymatic activity. Key residues include:

  • E21 (glutamic acid): Predicted to activate the S27 residue

  • E17 (glutamic acid): May initiate the reaction when E21 is mutated

  • S26 and S27 (serine residues): Critical for phosphatase activity, with partial functional redundancy

  • R174 (arginine): Essential for dephosphorylation activity

The spatial arrangement of these residues creates a functional active site that can bind the C55-PP substrate and facilitate the nucleophilic attack on the terminal phosphate. The enzyme's activity is dependent on divalent cations, as evidenced by the inhibition of catalytic activity in the presence of EDTA, a metal chelator .

What methodologies are most effective for monitoring UppP enzymatic activity?

Real-time monitoring of UppP activity can be effectively achieved using mass spectrometry-based approaches. This technique allows researchers to observe the processing of C55-PP by wild-type UppP and various mutants . The methodology involves:

  • Preparation of purified recombinant UppP enzyme

  • Incubation with substrate (C55-PP) under controlled conditions

  • Acquisition of mass spectra at different time points

  • Tracking the relative intensities of peaks corresponding to enzyme-bound substrate and product

For optimal results, the reaction can be modulated by adjusting the concentration of divalent cations, such as using 20 μM EDTA to decrease the concentration of divalent cations in the reaction mixture . This approach allows for capturing the gradual conversion of substrate to product by slowing down the reaction rate.

Table 1: Recommended Conditions for UppP Activity Assays

ParameterOptimal ConditionNotes
Substrate concentration10 μMC55-PP
Enzyme concentration3.5 μMRecombinant UppP
Divalent cation modifier20 μM EDTATo slow reaction for monitoring
TemperatureRoom temperature~25°C
Monitoring methodMass spectrometryTracks substrate-product conversion

How do specific mutations affect UppP catalytic activity?

Mutational studies provide critical insights into the catalytic mechanism of UppP. Several key mutations have been studied:

  • E21A mutation: Surprisingly, this mutation shows no detectable difference in dephosphorylation activity compared to wild-type UppP, suggesting that E17 may compensate for this mutation .

  • S26A and S27A single mutations: Both show very weak phosphatase activity even after prolonged incubation with C55-PP, indicating their importance in catalysis .

  • S26A/S27A double mutation: This mutation completely abrogates enzymatic activity, demonstrating that while S26 and S27 can partially compensate for each other, at least one of these residues is absolutely required for function .

  • R174A and S26A/R174A mutations: These variants are completely inactive with respect to C55-PP dephosphorylation, highlighting the critical role of R174 in the catalytic mechanism .

These findings suggest a complex catalytic mechanism involving multiple residues, with some functional redundancy between certain amino acids. The data support a model where S27 (or possibly S26) performs a nucleophilic attack on the substrate phosphate, activated by E21 (or possibly E17) .

What factors influence UppP substrate specificity?

UppP demonstrates clear substrate specificity, preferentially processing C55-PP to C55-P without further dephosphorylation to undecaprenol . Several factors appear to influence this specificity:

  • Substrate structure: The long hydrophobic undecaprenyl chain and the two phosphate groups are recognized by specific binding pockets within UppP.

  • Divalent cations: The presence of divalent cations is critical for enzymatic activity, as evidenced by the inhibition observed with 200 μM EDTA .

  • Protein conformation: The spatial arrangement of the catalytic residues (E21, S26, S27, R174) creates a specific binding pocket that accommodates C55-PP but may exclude other potential substrates.

Interestingly, UppP appears to be distinct from other bacterial phosphatases such as PgpB, which exhibits broader substrate specificity including phosphatidyl glycerol phosphate (PGP), lysophosphatidic acid (lyso-PA), and diacylglycerol pyrophosphate (DGPP) .

How does S. maltophilia UppP compare to homologous enzymes in other bacterial species?

While the search results don't provide direct comparative data between S. maltophilia UppP and homologs from other bacterial species, we can infer several points:

  • Functional conservation: The catalytic mechanism involving serine residues and dependence on divalent cations appears to be conserved across bacterial UppP enzymes, including those from E. coli .

  • Structural similarities: The critical catalytic residues (E21, S26, S27, R174) identified in S. maltophilia UppP likely have counterparts in homologous enzymes from other species, reflecting evolutionary conservation of essential functional domains.

  • Substrate specificity: The specific processing of C55-PP to C55-P without further dephosphorylation appears to be a conserved feature across bacterial UppP enzymes .

Researchers investigating S. maltophilia UppP should consider comparative analyses with homologs from other bacterial species to identify unique features that could be exploited for species-specific targeting.

What is the mechanism of UppP inhibition by antibiotics?

The search results provide specific information about the inhibition of UppP by bacitracin . When 100 μM bacitracin is incubated with 3.5 μM UppP, followed by the addition of 10 μM substrate (C55-PP), little to no protein-bound substrate or product is detected after 30 minutes .

The mechanism of inhibition appears to involve competition between bacitracin and UppP for binding to C55-PP. Bacitracin forms a complex with C55-PP, preventing the substrate from binding to the enzyme's active site . This competitive inhibition mechanism explains why little or no enzyme-bound substrate or product is detected in the presence of bacitracin.

This finding has important implications for understanding antimicrobial resistance in S. maltophilia and potentially developing new therapeutic approaches that target UppP or its interaction with substrates.

How can researchers optimize expression and purification of recombinant S. maltophilia UppP?

Based on the experimental approaches described in the search results, researchers can consider the following strategies for expression and purification of recombinant S. maltophilia UppP:

  • Expression system: Use of E. coli as a heterologous expression system appears to be effective, as evidenced by the successful production of wild-type and mutant UppP proteins .

  • Purification strategy: Since UppP is a membrane protein, purification likely involves:

    • Membrane fraction isolation

    • Detergent solubilization

    • Affinity chromatography (possibly using a His-tag)

    • Size exclusion chromatography

  • Activity verification: Functional activity of the purified protein can be confirmed using the mass spectrometry-based assay described in the search results .

  • Protein stability considerations: As a membrane protein, UppP likely requires specific buffer conditions containing appropriate detergents to maintain solubility and activity after purification.

What analytical methods are most suitable for studying UppP-substrate interactions?

The search results highlight mass spectrometry as a powerful technique for studying UppP-substrate interactions . This approach allows researchers to:

  • Detect enzyme-bound substrate complexes (UppP-C55-PP)

  • Monitor the conversion of substrate to product over time

  • Observe the effects of mutations on substrate binding and catalysis

  • Evaluate the impact of inhibitors on enzyme-substrate interactions

Additional analytical techniques that would complement mass spectrometry include:

  • Isothermal titration calorimetry (ITC) to quantify binding thermodynamics

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Structural studies using X-ray crystallography or cryo-electron microscopy to visualize the enzyme-substrate complex

How can researchers differentiate between direct and indirect effects of UppP inhibition?

When studying UppP inhibition, researchers should employ multiple approaches to distinguish direct enzyme inhibition from indirect effects:

  • In vitro enzyme assays: Direct measurement of UppP activity using purified enzyme and substrate, with and without potential inhibitors .

  • Binding studies: Evaluation of direct binding between UppP and inhibitors using techniques such as ITC, SPR, or fluorescence-based assays.

  • Structural studies: Investigation of potential conformational changes induced by inhibitor binding.

  • Cellular assays: Assessment of physiological effects of UppP inhibition in bacterial cells, including changes in cell wall integrity, growth rate, and antibiotic susceptibility.

  • Comparative analysis: Examination of inhibitor effects on mutant UppP variants to identify specific interactions between the inhibitor and catalytic residues.

By integrating these approaches, researchers can build a comprehensive understanding of how potential inhibitors affect UppP function at the molecular and cellular levels.

What are the potential applications of UppP research in developing novel antimicrobials?

S. maltophilia is an emerging global multiple-drug-resistant organism with increasingly challenging treatment options . UppP research offers several promising avenues for developing novel antimicrobial strategies:

  • Structure-based drug design: Detailed understanding of UppP's catalytic mechanism and binding site architecture can guide the design of specific inhibitors targeting this essential enzyme.

  • Combination therapies: Knowledge of how existing antibiotics like bacitracin interact with UppP can inform the development of combination therapies that target multiple aspects of cell wall biosynthesis.

  • Species-specific targeting: Identification of unique features in S. maltophilia UppP compared to homologs in other bacteria could enable the development of targeted antimicrobials with reduced effects on beneficial microbiota.

  • Alternative approaches: Beyond direct enzyme inhibition, understanding UppP's role in cell wall biosynthesis could inspire alternative strategies such as immunological approaches targeting exposed epitopes associated with this pathway.

How might UppP research contribute to understanding S. maltophilia pathogenesis?

S. maltophilia causes particularly serious lung infections in individuals with cystic fibrosis, leading to high mortality rates . Research on UppP could contribute to understanding S. maltophilia pathogenesis in several ways:

  • Cell wall integrity: UppP's role in peptidoglycan synthesis directly impacts cell wall structure, which may influence bacterial persistence during infection.

  • Biofilm formation: S. maltophilia establishes chronic infections through biofilm formation , and cell wall components are known to contribute to biofilm structure. Understanding how UppP activity influences cell surface properties could provide insights into biofilm development.

  • Host-pathogen interactions: Cell surface components affected by UppP activity may interact with host immune receptors, potentially modulating immune responses during infection.

  • Stress responses: UppP function may be regulated in response to environmental stresses encountered during infection, contributing to bacterial adaptation within the host.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.