Recombinant Stenotrophomonas maltophilia UPF0761 membrane protein Smlt0865 (Smlt0865)

Shipped with Ice Packs
In Stock

Description

Introduction to Stenotrophomonas maltophilia and Smlt0865

Stenotrophomonas maltophilia has emerged as a bacterial pathogen of increasing clinical significance due to its rising prevalence in human disease worldwide and its intrinsic multidrug resistance profile. This gram-negative bacterium serves as an important model organism for studying resistance mechanisms, informing rational drug design, and improving chemotherapy protocols . Within the S. maltophilia genome, the Smlt0865 gene encodes a membrane protein belonging to the UPF0761 protein family, a group of proteins with conserved sequences but largely uncharacterized functions.

The Smlt0865 protein is identified in the complete genome of Stenotrophomonas maltophilia K279a strain, where it is annotated as a membrane protein . As part of the UPF0761 family (where "UPF" designates "Uncharacterized Protein Family"), this protein represents one of many bacterial membrane proteins whose specific biological functions remain to be fully elucidated. Recombinant versions of this protein have been developed to facilitate research into its structure, function, and potential roles in bacterial physiology.

Genomic Context and Classification

The Smlt0865 gene is located within the S. maltophilia K279a genome sequence. According to genome annotation data, it is positioned among other genes encoding various metabolic and structural proteins . The UPF0761 classification indicates that this protein belongs to a family of related sequences that share conserved domains and structural features, but whose precise biological roles are not yet well defined in scientific literature.

Expression and Purification Methods

The recombinant Smlt0865 protein is typically expressed in Escherichia coli expression systems, which provide an efficient platform for producing bacterial proteins. The full-length protein (amino acids 1-424) is expressed with an N-terminal histidine tag (His-tag), which facilitates purification using affinity chromatography techniques . The use of E. coli as an expression host allows for scalable production of the recombinant protein while maintaining its native sequence integrity.

Reconstitution Protocol

For experimental use, the following reconstitution procedure is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) is recommended for aliquots intended for long-term storage

  4. The default final concentration of glycerol recommended by manufacturers is typically 50%

These handling procedures are designed to maximize protein stability and minimize degradation during storage and experimental use.

Stenotrophomonas maltophilia as a Research Model

S. maltophilia has gained importance as a research model due to its intrinsic multidrug resistance mechanisms. The bacterium has been studied to identify novel resistance pathways against various antibiotics, including ceftazidime, amikacin, levofloxacin, and minocycline . Understanding membrane proteins like Smlt0865 may contribute to elucidating these resistance mechanisms or identifying new therapeutic targets.

Membrane Proteins and Antimicrobial Resistance

Membrane proteins often play crucial roles in antimicrobial resistance through mechanisms such as:

  1. Efflux pump components that expel antibiotics from bacterial cells

  2. Modified membrane permeability that prevents antibiotic entry

  3. Transport systems involved in cell wall synthesis or remodeling

  4. Signaling proteins that regulate resistance gene expression

While the specific function of Smlt0865 is not established in the available search results, its nature as a membrane protein suggests potential involvement in one or more of these processes. Research into this protein could therefore contribute to understanding S. maltophilia's intrinsic resistance mechanisms.

Potential Research Applications

The recombinant Smlt0865 protein could be utilized in various research applications:

  1. Structural studies to determine three-dimensional conformation

  2. Functional assays to identify biological activities

  3. Protein-protein interaction studies to identify binding partners

  4. Antibody development for localization and expression studies

  5. Crystallography for detailed structural analysis

  6. Drug screening to identify compounds that interact with the protein

Such studies could provide insights not only into the specific functions of Smlt0865 but also into broader aspects of S. maltophilia biology and potential therapeutic approaches.

Technical Applications in Membrane Protein Research

Research methodologies for studying membrane proteins like Smlt0865 have advanced significantly in recent years. One innovative approach is Native-nanoBleach, which enables determination of membrane protein oligomeric states at single-molecule resolution in native membranes .

Analysis of Oligomeric States

The oligomeric state of membrane proteins is crucial for understanding their function and assembly. While the search results do not specify the oligomeric state of Smlt0865, techniques like Native-nanoBleach could be applied to determine whether this protein functions as a monomer or forms higher-order structures such as dimers, trimers, or tetramers .

Recent research has demonstrated the application of such techniques to various membrane proteins, including transporters and channels with well-defined stoichiometries. These methods can distinguish between genuine oligomeric interfaces and proteins that are simply in close proximity within the membrane environment .

Challenges in Membrane Protein Research

Membrane proteins present unique challenges for research due to their hydrophobic nature and requirement for lipid environments. Some key challenges include:

  1. Achieving single-molecule density of membrane proteins on native membranes

  2. Distinguishing between functional oligomers and coincidental proximity

  3. Maintaining protein stability during purification and analysis

  4. Achieving sufficient expression levels for structural studies

Advanced techniques with nanometer-scale resolution are essential for overcoming these challenges. For proteins like Smlt0865, these methods could reveal important structural and functional characteristics that are not apparent from sequence analysis alone .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order remarks, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Smlt0865; UPF0761 membrane protein Smlt0865
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-424
Protein Length
full length protein
Species
Stenotrophomonas maltophilia (strain K279a)
Target Names
Smlt0865
Target Protein Sequence
MEPLDTLNLWMERARDRARAISFGRFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFG VLSAFPVFDRWSDQLSDYVFSNFVPNAARAAEGYLRQFSASAGQLTAAGFIALVVSLLIT LNSVEETFNQIWRVGSTRPKLTRFLVYWTVLTLGAMLAAASLAVSARVFAMPLFGTQEGR WLAELALRLAPILIEFVCITLMFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGS FQSYQKLYGTVAFVPILLLWIYLCWVAVLLGASLSSSMAAFRYQPVELRLPQGYEFYGLL RLLGRFHHARAKGKGLADDEILRLEPMLTDSLLQDLACNLQEIGLLRRDERGEWLLSRDL DQVSLADLYECTQLRIPVAEQHLPYRDDSLGRAALAALDDLRLPLRERLKRKVSDIYTDS GDMP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Stenotrophomonas maltophilia UPF0761 membrane protein Smlt0865?

Stenotrophomonas maltophilia UPF0761 membrane protein Smlt0865 is a membrane-associated protein encoded by the Smlt0865 gene in the genome of Stenotrophomonas maltophilia strain K279a. It belongs to the UPF0761 protein family, whose specific functions remain under investigation. The protein has 424 amino acids and is primarily located in the bacterial membrane, as indicated by its structural features . S. maltophilia is a clinically significant organism, being the third most frequent non-fermentative Gram-negative bacilli involved in nosocomial infections, commonly causing severe conditions such as bacteremia and pneumonia .

How does Smlt0865 compare to other membrane proteins in S. maltophilia?

Among the membrane proteins identified in S. maltophilia, Smlt0865 belongs to a group of proteins that can be computationally detected by membrane protein prediction tools like ProtRAP-LM. Recent research using ProtRAP-LM has demonstrated improved identification of various types of membrane proteins, including transmembrane span proteins, single-pass transmembrane proteins, and membrane-anchored proteins .

When comparing Smlt0865 to the broader membrane proteome of S. maltophilia, it's important to note that ProtRAP-LM has shown the ability to identify a high percentage (up to 97.4%) of known transmembrane proteins annotated in UniProt . This suggests that computational approaches are increasingly reliable for classifying proteins like Smlt0865 within the membrane protein landscape of S. maltophilia.

What are the recommended methods for expressing and purifying recombinant Smlt0865?

For effective expression and purification of recombinant Smlt0865, the following methodology is recommended:

Expression System Selection:

  • Use E. coli BL21(DE3) or similar expression strains optimized for membrane proteins

  • Consider specialized expression vectors containing fusion tags (His6, MBP, or SUMO) to improve solubility and facilitate purification

  • For challenging membrane proteins like Smlt0865, cell-free expression systems may be considered as alternatives to traditional in vivo methods

Optimization Protocol:

  • Transform expression vector into competent cells

  • Culture in LB medium supplemented with appropriate antibiotics

  • Induce expression with IPTG at lower temperatures (16-20°C) to enhance proper folding

  • Harvest cells by centrifugation (5,000 g, 10 minutes, 4°C)

  • Resuspend in buffer containing detergents suitable for membrane proteins (e.g., DDM, LDAO)

  • Lyse cells by sonication or high-pressure homogenization

  • Centrifuge at high speed (100,000 g, 1 hour) to separate membrane fraction

  • Solubilize membrane proteins using appropriate detergents

  • Purify using affinity chromatography based on the fusion tag

  • Perform size exclusion chromatography for final purification

Storage Considerations:
Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage . Avoid repeated freeze-thaw cycles, and prepare working aliquots stored at 4°C for up to one week.

How can I design experiments to study the function of Smlt0865?

Designing robust experiments to elucidate the function of Smlt0865 requires a systematic approach following key experimental design principles :

Step 1: Define Variables

  • Independent variables: Genetic modifications to Smlt0865 (knockout, point mutations, overexpression)

  • Dependent variables: Bacterial growth rate, membrane integrity, antibiotic resistance, virulence in infection models

  • Extraneous variables to control: Growth conditions, bacterial strain background, expression levels

Step 2: Formulate Specific Hypotheses
Based on its membrane localization, potential hypotheses might include:

  • Smlt0865 contributes to membrane integrity in S. maltophilia

  • Smlt0865 participates in antibiotic resistance mechanisms

  • Smlt0865 plays a role in virulence during host infection

Step 3: Design Experimental Treatments

  • Generate Smlt0865 knockout mutants using CRISPR-Cas9 or homologous recombination

  • Create complemented strains expressing wild-type Smlt0865

  • Develop point mutations in conserved domains to assess structure-function relationships

  • Construct fluorescently tagged versions for localization studies

Step 4: Establish Experimental Groups

  • Between-subjects design: Compare wild-type, knockout, and complemented strains

  • Within-subjects design: Track changes in the same strain under different conditions

Step 5: Plan Measurement Methods

  • Growth curve analysis for fitness assessment

  • Membrane permeability assays

  • Antibiotic susceptibility testing

  • Proteomic analysis to identify interaction partners

  • Infection models to assess virulence contributions

What techniques are recommended for assessing membrane localization of Smlt0865?

To confirm and characterize the membrane localization of Smlt0865, a multi-technique approach is recommended:

Computational Prediction:

  • Utilize membrane protein prediction tools like ProtRAP-LM and TMbed to identify potential transmembrane regions

  • Apply secondary structure prediction to identify membrane-spanning domains

Experimental Verification:

  • Subcellular Fractionation: Separate cellular compartments (cytoplasm, inner membrane, outer membrane) through differential centrifugation and detergent extraction

  • Western Blotting: Use anti-Smlt0865 antibodies or tag-specific antibodies to detect the protein in membrane fractions

  • Fluorescence Microscopy: Create fluorescent protein fusions (GFP-Smlt0865) to visualize cellular localization

  • Immunogold Electron Microscopy: Provides high-resolution imaging of protein localization within the membrane

Topological Mapping:

  • Protease Accessibility: Limited proteolysis of intact cells versus permeabilized cells

  • Cysteine Scanning Mutagenesis: Introduce cysteine residues at various positions followed by labeling with membrane-impermeable reagents

  • PhoA/LacZ Fusion Analysis: Create fusions at different positions to determine cytoplasmic versus periplasmic orientation

How might Smlt0865 contribute to S. maltophilia pathogenicity and virulence?

The potential role of Smlt0865 in S. maltophilia pathogenicity should be considered in the context of this organism's clinical significance as the third most frequent non-fermentative Gram-negative bacilli in nosocomial infections . While the specific function of Smlt0865 remains to be fully characterized, several research approaches can help determine its potential contributions to pathogenicity:

Comparison with Known Virulence Factors:
Examine whether Smlt0865 shares structural similarities with characterized virulence factors from related pathogens. Membrane proteins often contribute to virulence through mechanisms such as:

  • Adhesion to host cells

  • Biofilm formation

  • Efflux pump activity (antibiotic resistance)

  • Secretion system components

  • Immune evasion

Gene Expression Studies:
Analyze Smlt0865 expression under conditions that mimic the host environment:

  • Growth in serum or lung surfactant

  • Exposure to antimicrobial peptides

  • Oxygen limitation

  • Biofilm versus planktonic growth

Infection Model Experiments:
Compare wild-type and Smlt0865 knockout strains in:

  • Cell culture invasion/adherence assays

  • Galleria mellonella infection model

  • Mouse pneumonia or bacteremia models

  • Assessment of bacterial burden, inflammation markers, and survival outcomes

Given that S. maltophilia causes severe infections such as bacteremia and pneumonia , understanding Smlt0865's potential contributions to these clinical manifestations would be particularly valuable.

What bioinformatic approaches are most effective for predicting Smlt0865 function?

Advanced bioinformatic analyses can provide crucial insights into the potential functions of poorly characterized proteins like Smlt0865:

Sequence-Based Analysis:

  • Homology Searches: Utilize PSI-BLAST, HHpred, or HMMER to identify distant homologs with known functions

  • Conserved Domain Analysis: Search CDD, Pfam, and InterPro databases to identify functional domains

  • Motif Identification: Analyze sequence for conserved motifs associated with specific functions

Structure-Based Predictions:

  • Structural Modeling: Generate 3D models using AlphaFold2 or RoseTTAFold

  • Structural Comparisons: Compare predicted structures to known proteins using DALI or TM-align

  • Binding Site Prediction: Identify potential ligand-binding pockets using tools like FTSite

Genomic Context Analysis:

  • Gene Neighborhood: Examine neighboring genes in the S. maltophilia genome

  • Co-expression Analysis: Identify genes showing similar expression patterns

  • Phylogenetic Profiling: Compare presence/absence patterns across bacterial species

Integrated Approaches:
Create a functional prediction consensus using multiple tools such as ProtRAP-LM for membrane contact prediction . Recent advances in protein accessibility prediction methods like ProtRAP-LM have shown particular effectiveness in identifying membrane proteins, with up to 97.4% coverage of known transmembrane proteins annotated in UniProt .

How can I investigate protein-protein interactions involving Smlt0865?

Investigating protein-protein interactions (PPIs) for membrane proteins like Smlt0865 presents unique challenges but is crucial for understanding function. A comprehensive approach includes:

In Vitro Methods:

  • Pull-Down Assays: Use purified recombinant Smlt0865 with appropriate tags as bait

  • Co-Immunoprecipitation: Generate antibodies against Smlt0865 or use tagged versions

  • Cross-Linking Mass Spectrometry: Identify interaction interfaces through chemical cross-linking followed by MS analysis

In Vivo Approaches:

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins (BACTH system)

  • Förster Resonance Energy Transfer (FRET): Tag Smlt0865 and potential partners with fluorescent proteins

  • Proximity-Dependent Biotin Identification (BioID): Fuse Smlt0865 to a biotin ligase to identify proximal proteins

Computational Prediction:

  • Interactome Databases: Search STRING, IntAct for predicted interactions

  • Coevolution Analysis: Identify co-evolving residues suggesting interaction partners

  • Docking Simulations: Model potential interactions with predicted partners

Data Analysis and Validation:

TechniqueAdvantagesLimitationsValidation Approach
Pull-DownDirect detection of physical interactionsPotential for non-specific bindingReverse pull-down, competitive inhibition
Bacterial Two-HybridIn vivo detectionNot all interactions detectableMutational analysis of interaction interfaces
FRETReal-time in vivo detectionRequires fluorescent taggingDistance controls, acceptor photobleaching
Cross-Linking MSIdentifies interaction surfacesComplex data analysisSite-directed mutagenesis of cross-linked residues
BioIDDetects transient interactionsRequires expression of fusion proteinProximity controls, comparison with known interactors

What are common challenges in membrane protein research relevant to Smlt0865 studies?

Working with membrane proteins like Smlt0865 presents several technical challenges that researchers should anticipate:

Expression and Purification Challenges:

  • Low expression levels compared to soluble proteins

  • Proper folding and membrane integration issues

  • Aggregation during purification

  • Detergent selection critical for maintaining native structure

Solution Strategies:

  • Optimize expression conditions (temperature, inducer concentration)

  • Test multiple detergents systematically (DDM, LDAO, Fos-choline)

  • Consider fusion partners that enhance solubility (MBP, SUMO, Mistic)

  • Explore nanodiscs or amphipols as alternatives to detergents

Structural Analysis Limitations:

  • Difficulty obtaining crystals for X-ray crystallography

  • Challenges in NMR analysis due to size and detergent micelles

  • Cryo-EM sample preparation complexities

Alternative Approaches:

  • Employ structural prediction tools like AlphaFold2

  • Use hydrogen-deuterium exchange mass spectrometry for dynamic information

  • Apply solid-state NMR for specific structural questions

  • Utilize computational tools like ProtRAP-LM that have demonstrated success in membrane protein analysis

How can I validate computational predictions about Smlt0865 experimentally?

Validating computational predictions about Smlt0865 requires a systematic experimental approach:

For Predicted Membrane Topology:

  • Accessibility Mapping: Create cysteine mutants throughout the sequence and test accessibility to membrane-impermeable reagents

  • Protease Protection Assays: Determine which regions are protected by the membrane

  • Reporter Fusion Analysis: Fuse reporter proteins to different domains and assess cellular localization

For Predicted Functional Domains:

  • Site-Directed Mutagenesis: Target conserved residues in predicted functional domains

  • Domain Swapping: Exchange domains with homologous proteins

  • Truncation Analysis: Create systematic truncations to isolate functional domains

For Predicted Interactions:

  • Co-Immunoprecipitation: Test specific predicted interaction partners

  • Yeast/Bacterial Two-Hybrid: Verify binary interactions

  • Surface Plasmon Resonance: Measure binding kinetics and affinities

Validation Framework:

Prediction TypeValidation MethodExpected OutcomeControl Experiment
Transmembrane regionsCysteine scanningProtected cysteines in TM regionsKnown TM protein control
Functional motifMutagenesis of key residuesLoss of specific functionMutation of non-conserved residues
Protein interactionCo-IP or pull-downDetection of partner proteinNon-specific antibody control
β-sheet structureCircular dichroismCharacteristic β-sheet spectrumα-helical protein control

Tools like ProtRAP-LM have shown particular strength in identifying β-sheet-containing membrane proteins compared to other predictors like TMbed , making experimental validation of these structures especially valuable for Smlt0865 characterization.

What controls should be included when designing experiments involving Smlt0865?

Proper experimental controls are essential for generating reliable data about Smlt0865:

Genetic Controls:

  • Wild-type S. maltophilia: Baseline comparison for all experiments

  • Smlt0865 Knockout: Negative control for function

  • Complemented Strain: Restoration of function confirms phenotype is due to Smlt0865

  • Point Mutants: Critical for structure-function analysis

  • Tagged Controls: Empty vector expressing only the tag

Expression Controls:

  • qRT-PCR: Verify transcript levels

  • Western Blot: Confirm protein expression levels

  • Localization Controls: Known membrane and cytoplasmic proteins

Functional Assay Controls:

Assay TypePositive ControlNegative ControlTechnical Control
Membrane integrityKnown membrane protein mutantWild-type strainDetergent treatment
Antibiotic resistanceKnown resistance geneSusceptible strainDrug concentration gradient
Virulence assaysKnown virulence factor mutantAvirulent strainHost cell viability
Protein interactionKnown interacting pairNon-interacting proteinsInput protein quantification

Experimental Design Controls:

  • Biological Replicates: Independent bacterial cultures

  • Technical Replicates: Repeated measurements from the same sample

  • Blinding: When scoring phenotypes susceptible to observer bias

  • Randomization: When working with animal models or complex experimental setups

What is the potential relevance of Smlt0865 research to clinical S. maltophilia infections?

Research on Smlt0865 has potential clinical significance due to S. maltophilia's role as a significant nosocomial pathogen. S. maltophilia is the third most frequent non-fermentative Gram-negative bacilli in hospital-acquired infections, causing serious conditions like bacteremia and pneumonia . The mortality rate for S. maltophilia pneumonia can be slightly higher than for bacteremia, potentially due to factors such as advanced patient age, higher APACHE II and SOFA scores, and inappropriate antibiotic use .

Potential Clinical Applications:

  • Diagnostic Development: If Smlt0865 is determined to be accessible on the bacterial surface, it could serve as a target for rapid diagnostic tests

  • Therapeutic Target Identification: Membrane proteins often make suitable drug targets due to their accessibility

  • Virulence Mechanism Understanding: May reveal new approaches to mitigate infection severity

  • Antibiotic Resistance Insights: If Smlt0865 contributes to antimicrobial resistance, understanding its mechanism could inform new treatment strategies

Research shows that inappropriate antibiotic use and multiple organ dysfunction syndrome are independent risk factors for 14-day mortality in S. maltophilia infections . If Smlt0865 plays a role in antibiotic resistance mechanisms, this could have direct clinical relevance.

How can findings about Smlt0865 contribute to addressing antimicrobial resistance?

Membrane proteins often play crucial roles in antimicrobial resistance mechanisms. Research on Smlt0865 could contribute to addressing this challenge in several ways:

Potential Resistance Mechanisms to Investigate:

  • Efflux Pump Component: Determine if Smlt0865 functions as part of an efflux system that exports antibiotics

  • Membrane Permeability: Assess whether it influences the uptake of antimicrobials

  • Biofilm Formation: Evaluate its role in biofilm development, which contributes to antibiotic tolerance

  • Stress Response: Investigate its involvement in bacterial adaptations to antibiotic pressure

Research Applications:

  • Structure-Based Drug Design: If Smlt0865 is confirmed as a resistance factor, its structural information could guide development of inhibitors

  • Combination Therapy Approaches: Identify agents that could target Smlt0865 function alongside conventional antibiotics

  • Resistance Monitoring: Develop assays to track expression levels in clinical isolates

Given that S. maltophilia infections already show significant mortality rates, with inappropriate antibiotic use being an independent risk factor , any insights into novel resistance mechanisms could have meaningful clinical impact.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.