Recombinant Stomatin-1 (sto-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
sto-1; F08C6.4; Stomatin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sto-1
Target Protein Sequence
MQPSETVEMQEMAQPSGQQRDVEARVQSAPANHSHDAGCTEMFCIAMSYVLIFLTFPVSV FMCIKIVQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNIDLRVASYNVPSQEILSR DSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKIS ADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAEGELRAS AALAEAATIISKSEGAMQLRYLHTLNAISSEKTSTIIFPFPMEILGGISKVGSGGTSQNF PVQEMMNAALQSIQRQDTVPATASSSGSRL
Uniprot No.

Target Background

Database Links

STRING: 6239.F08C6.4a

UniGene: Cel.17438

Protein Families
Band 7/mec-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural organization of stomatin and how does it differ from stomatin-like protein-1 (SLP-1)?

Stomatin is a 31 kDa monotopic integral membrane protein containing a characteristic SPFH/PHB domain (Stomatin, Prohibitin, Flotillin, HflK/C). It features a hydrophobic domain anchoring it to the membrane, palmitoylation sites, and a coiled-coil domain essential for oligomerization .

SLP-1, by contrast, has a unique bipartite structure containing both the stomatin domain and a sterol carrier protein-2 (SCP-2) domain . This additional SCP-2 domain suggests a specialized role in sterol/lipid transfer and transport. The human recombinant SLP-1 (STOML1) contains 343 amino acids (79-398 a.a) with a molecular mass of approximately 37kDa .

Key structural features that distinguish stomatin and SLP-1:

FeatureStomatinSLP-1
Molecular weight31 kDa37 kDa
DomainsSPFH/PHB domain, coiled-coilSPFH/PHB domain, SCP-2 domain
Membrane associationPlasma membrane and cytoplasmic vesiclesPrimarily late endosomes
N-terminal targeting signalsNone specific for endosomesContains GYXXΦ sorting signal
PalmitoylationPresentPresent

What experimental approaches are recommended for studying stomatin's function as a regulator of membrane transporters?

To investigate stomatin's regulatory role on membrane transporters:

  • Stopped-flow fluorescence-based assays: This methodology has been successfully employed to measure AE1-mediated chloride/bicarbonate exchange in the presence or absence of stomatin. Researchers have used pH- or chloride-sensitive fluorescent probes to track ion movement in real-time .

  • Proximity Ligation Assays (PLA): This technique has proven effective for confirming direct protein-protein interactions between stomatin and its targets (e.g., AE1) in both recombinant expression systems and native cells .

  • Cellular expression systems: Expressing recombinant stomatin in cell lines with low endogenous stomatin (such as A431 cells) allows for controlled studies of wild-type versus mutant stomatin proteins .

  • Analysis of stomatin-deficient primary cells: Comparing transport activities in RBCs from patients with stomatin deficiency provides valuable insights into physiological functions. For example, ghosts from stomatin-deficient RBCs showed a 47% decreased permeability to HCO3- and a 42% decrease in Cl- efflux compared to controls .

  • Co-immunoprecipitation studies: These can verify direct physical interactions between stomatin and transporter proteins in native or recombinant systems .

How does the subcellular localization of stomatin and SLP-1 influence their functional roles?

The distinct subcellular localizations of stomatin and SLP-1 directly impact their functional capabilities:

Stomatin localization and function:

  • Primarily localizes to the plasma membrane and cytoplasmic vesicles in fibroblasts, epithelial, and endothelial cells

  • Associates with late endosomes, lipid droplets, and specialized endosomes/granules in hematopoietic cells

  • In platelets, stomatin is predominantly found in α-granules but relocates to the plasma membrane upon activation

  • In neutrophils, stomatin associates with azurophil and other specific granules, and similarly relocates to the plasma membrane during activation

  • This dynamic localization allows stomatin to regulate plasma membrane channels (like ASIC channels and GLUT1) while also participating in vesicular trafficking

SLP-1 localization and function:

  • Predominantly localizes to late endosomal compartments, unlike stomatin which is also found at the plasma membrane

  • Contains a GYXXΦ sorting signal at the N-terminus that targets it to late endosomes

  • When this sorting signal is mutated, SLP-1 relocates to the plasma membrane, demonstrating the importance of this sequence for proper localization

  • The specific endosomal localization of SLP-1 appears critical for its role in cholesterol transfer and transport

  • When co-expressed with stomatin, SLP-1 can cause redistribution of stomatin from the plasma membrane to late endosomes, suggesting a role in modifying stomatin's localization and function

This differential localization explains why stomatin primarily regulates plasma membrane proteins, while SLP-1's functions center around endosomal processes, particularly cholesterol trafficking.

What is the molecular basis for stomatin's ability to modulate AE1 activity, and how can this be experimentally validated?

Stomatin positively modulates the transport activity of the Anion Exchanger 1 (AE1) through direct protein-protein interactions. The molecular mechanisms and experimental approaches include:

Molecular basis:

  • Stomatin directly interacts with AE1 as confirmed by Proximity Ligation Assays (PLA)

  • This interaction occurs in cholesterol-rich membrane domains (lipid rafts)

  • The modulation appears to be specific, as stomatin-deficient RBCs show significantly decreased AE1-mediated ion exchange without changes in AE1 expression levels

Experimental validation methods:

  • Quantitative stopped-flow measurements: Studies comparing AE1 activity with and without stomatin have shown:

    • 30% higher permeabilities associated with AE1 activity in HEK293 cells overexpressing stomatin compared to cells with only endogenous stomatin expression

    • 47% decreased permeability to HCO3- in stomatin-deficient patient RBCs

    • 42% decrease in Cl- efflux kinetics in stomatin-deficient patients

  • Proximity Ligation Assay optimization: PLA signals are clearly visible in stomatin-positive control RBCs but absent in stomatin-deficient cells, providing visual confirmation of the interaction .

  • Structure-function analysis using mutants: Creating point mutations or deletion mutants in key domains of stomatin allows for determination of which regions are essential for the interaction with AE1 .

  • Lipid raft association studies: The CRAC/CARC (residues 55-68) and ORA/CARC (residues 263-273) domains of stomatin are equally important for association with cholesterol-rich domains, which may be crucial for AE1 modulation .

  • Detergent-resistant membrane (DRM) fractionation: This approach can be used to confirm co-localization of stomatin and AE1 in the same membrane microdomains .

The positive modulation by stomatin on AE1 activity (increased activity by 30-47%) is particularly notable as stomatin has been shown to down-regulate the activity of many other channels and transporters.

What experimental strategies can be employed to study the role of SLP-1 in cholesterol trafficking?

SLP-1's unique structure containing both a stomatin domain and a sterol carrier protein-2 (SCP-2) domain makes it particularly interesting for studies of cellular cholesterol trafficking. Advanced experimental approaches include:

  • Cholesterol accumulation assays: Under conditions of blocked cholesterol efflux from late endosomes, SLP-1 induces the formation of enlarged, cholesterol-filled, weakly LAMP-2-positive, acidic vesicles in the perinuclear region. This effect depends specifically on the SCP-2 domain of SLP-1 .

  • Domain-specific mutants: Creating SLP-1 variants lacking the SCP-2 domain or with point mutations in this domain can help determine which residues are critical for cholesterol transfer activity .

  • Live-cell imaging with fluorescent cholesterol analogs: This approach allows real-time visualization of cholesterol movement in cells expressing wild-type or mutant SLP-1.

  • Lipidomic analysis: Mass spectrometry-based approaches can quantitatively assess changes in endosomal cholesterol content in the presence or absence of SLP-1.

  • Co-localization with late endosomal/lysosomal markers: In addition to LAMP-2, other markers like Rab7 can help characterize the SLP-1-positive compartments and their cholesterol content.

  • Cholesterol efflux assays: Measuring the rate of cholesterol efflux from late endosomes in cells with varying levels of SLP-1 expression can provide functional insights.

  • Interaction studies with other cholesterol transport proteins: Investigating potential interactions between SLP-1 and proteins like NPC1, NPC2, or ORP1L could reveal cooperative mechanisms in endosomal cholesterol transport.

The observation that SLP-1 induces cholesterol accumulation in late endosomes, dependent on its SCP-2 domain, provides strong evidence for its role in directional cholesterol transfer to this compartment.

How does stomatin contribute to anti-tumor activity, and what experimental models best demonstrate this function?

Recent research has revealed that stomatin exhibits anti-tumor activity through specific molecular mechanisms:

Molecular mechanisms:

  • Stomatin inhibits cell proliferation and induces apoptosis in cancer cells

  • Mechanistically, stomatin binds to phosphoinositide-dependent protein kinase 1 (PDPK1), a major activator of Akt

  • This binding impairs PDPK1 protein stability, decreasing PDPK1 protein levels and attenuating Akt-mediated signaling pathways

  • Higher stomatin expression is correlated with better disease-free ratio and progression-free ratio in prostate cancer patients (based on TCGA database analysis)

Regulatory pathways:

  • EphA-ephrin-A signaling suppresses stomatin expression in prostate cancer cells

  • When EphA-ephrin-A binding between prostate cancer cells is interrupted (by interactions with stromal cells or through knockdown of EphA3/7 or ephrin-A5), ERK1/2 is activated, leading to increased stomatin expression

  • Activated ERK1/2 phosphorylates ELK1 and ELK4, promoting transcriptional activation of the STOM gene

Experimental models and approaches:

  • Cell line models: LNCaP prostate cancer cells have been used effectively, especially in co-culture with prostate stromal (PrS) cells .

  • siRNA-mediated knockdown: Targeting EphA3, EphA7, or ephrin-A5 has demonstrated the regulatory mechanism of stomatin expression .

  • Mouse xenograft tumor models: These have confirmed the in vitro findings regarding stomatin's tumor-suppressive role .

  • Human prostate cancer tissue analysis: Immunohistochemistry shows that:

    • EphA3 phosphorylation is often higher in samples with higher Gleason scores (GS)

    • Stomatin expression is increased in lower GS samples where stroma contacts tumor regions

    • Stomatin expression is decreased in higher GS samples filled with tumor cells alone

    • Ki67-positive (proliferating) cells are rarely detected in lower GS samples with high stomatin expression

  • Correlation studies: Analysis of phosphorylated ERK1/2, ELK1, and stomatin expression in human cancer samples shows a positive correlation in lower GS samples and negative correlation in higher GS samples .

These findings suggest stomatin acts as part of a negative feedback loop in proliferative cancer cells that are in active contact with surrounding stromal cells, similar to oncogene-induced senescence mechanisms observed with tumor suppressors like ARF/INK4a.

What are the current methodological challenges in producing and working with recombinant stomatin and SLP-1 proteins?

Researchers face several technical challenges when producing and working with recombinant stomatin and SLP-1:

Expression system selection:

  • Human recombinant stomatin has been successfully expressed in wheat germ expression systems

  • Human SLP-1 has been produced in E. coli as a non-glycosylated polypeptide with an N-terminal His-tag

  • The choice of expression system significantly impacts protein folding, post-translational modifications, and functionality

Membrane protein solubility issues:

  • As integral membrane proteins, both stomatin and SLP-1 contain hydrophobic domains that can cause aggregation during expression and purification

  • Recombinant stomatin often requires careful optimization of detergent conditions to maintain native-like structure and function

  • For SLP-1, addition of 10% glycerol to storage buffers helps maintain stability

Post-translational modifications:

  • Native stomatin is palmitoylated, which affects its membrane association and function

  • Bacterial expression systems cannot reproduce this modification, potentially affecting protein behavior

  • Eukaryotic expression systems may be necessary when studying functions dependent on palmitoylation

Stability considerations:

  • Long-term storage requires careful optimization - SLP-1 is recommended to be stored at 4°C if used within 2-4 weeks or at -20°C for longer periods

  • Addition of carrier proteins (0.1% HSA or BSA) is recommended for long-term storage

  • Multiple freeze-thaw cycles should be avoided

Functional assays:

  • Demonstrating that recombinant proteins retain native functions requires specialized assays

  • For stomatin, interaction studies with ion channels and transporters require reconstitution into membrane systems or co-expression with partner proteins

  • Cholesterol transfer activity of SLP-1 may require specialized liposome-based assays or cellular systems with blocked cholesterol efflux

Recommended approaches:

  • Use mammalian or insect cell expression systems when studying interactions dependent on post-translational modifications

  • Consider fusion tags that enhance solubility while minimizing interference with function

  • Include appropriate detergents or lipids during purification to maintain native-like membrane association

  • Verify proper folding and oligomerization state before functional studies

  • For plant-based research on stomatin-like proteins, use of mitochondrial fractions is recommended when working with antibodies like Anti-STO1

How do stomatin interactions with acid-sensing ion channels (ASICs) contribute to sensory transduction?

Stomatin and acid-sensing ion channels (ASICs) play important roles in sensory transduction, particularly in mechanosensation:

Key interactions and effects:

  • Both stomatin and ASICs have been implicated in sensory transduction pathways

  • Stomatin regulates ASICs (specifically ASIC2 and ASIC3) channel activity

  • Loss of stomatin-ASIC interactions can significantly affect mechanosensitivity in specific subsets of skin afferents

  • Deletion of the ASIC3 gene or pharmacological blockade of this channel decreases adaptation rates specifically in rapidly adapting mechanoreceptors

Experimental evidence and approaches:

  • Electrophysiological recordings: Patch-clamp and other electrophysiological techniques can measure changes in ASIC channel properties when stomatin is present or absent.

  • Knockout models: Comparing sensory responses in wild-type vs. stomatin knockout or ASIC knockout animals reveals their functional roles in mechanosensation.

  • Co-immunoprecipitation and proximity ligation assays: These methods can confirm direct physical interactions between stomatin and ASICs in sensory neurons.

  • Structure-function studies: Analyzing which domains of stomatin are critical for ASIC regulation through deletion and point mutation approaches.

  • Ex vivo skin-nerve preparations: These allow measurement of afferent fiber responses to mechanical stimuli under conditions where stomatin-ASIC interactions are modulated.

Potential therapeutic implications:

  • Interfering with stomatin-ASIC interactions could have potential for treating mechanical pain

  • Understanding the molecular details of this interaction could lead to the development of novel analgesics that specifically target mechanosensitivity

These findings highlight how stomatin functions as a critical regulator of ion channel function in sensory systems, with its effects being highly specific to particular neuronal subtypes and sensory modalities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.