Recombinant Stomatin-4 (sto-4)

Shipped with Ice Packs
In Stock

Description

Introduction to Stomatin

Stomatin is an evolutionarily conserved, integral membrane protein present in various organisms . It is associated with cholesterol-rich membrane microdomains, also known as lipid rafts . First identified as the causative factor in Overhydrated Hereditary Stomatocytosis (OHSt), stomatin's functions are still being elucidated beyond its role as a major component of lipid rafts .

Structure and Function

Stomatin is an oligomeric, monotopic protein . It contains several functional domains, and studies have been conducted using truncated mutants to understand the roles of these domains .

Stomatin and Adipogenesis

Research indicates that stomatin plays a role in adipogenesis and adipocyte maturation by modulating related signaling pathways .

  • Lipid Droplet Enlargement Overexpression of stomatin in adipocyte-like cells promotes the growth and enlargement of lipid droplets (LDs) by facilitating LD-LD fusion . Time-lapse recordings have demonstrated this fusion event in cells overexpressing stomatin . Conditioned medium from cells overexpressing stomatin also increases the percentage of fused LDs .

  • Fatty Acid Uptake Stomatin enhances fatty acid uptake from the extracellular environment by recruiting effector molecules like FAT/CD36 translocase to lipid rafts, which promotes the internalization of fatty acids .

  • Cholesterol Content Stomatin affects cholesterol content and uptake in cells . Knockdown of stomatin decreases free cholesterol content and downregulates cholesterol uptake, whereas overexpression does not affect the content and distribution of free cholesterol .

  • CAV-1 Distribution Knockdown of stomatin decreases the amount of CAV-1 on plasma membranes compared to control cells .

Animal Studies

Transgenic mice overexpressing stomatin and fed a high-fat diet exhibit obesity, insulin resistance, and hepatic impairments . These phenotypes are not observed in transgenic animals fed a regular diet . Specifically, high-fat diet-fed transgenic mice show higher plasma insulin levels and are more glucose intolerant than control mice . These mice also exhibit larger liver mass and steatosis, related to impaired liver functions .

Stomatin Depletion

Knockdown of the stomatin gene inhibits adipogenesis, as evidenced by a lack of lipid accumulation after the induction of differentiation . The expression of genes involved in adipocytic differentiation is decreased by stomatin knockdown, which also inhibits LD maturation and growth .

Role in Mechanotransduction

Stomatin domain genes have a function in olfactory behavior .

Stomatin-like Protein-1 (SLP-1)

Stomatin-like Protein-1 interacts with stomatin and is targeted to late endosomes . Cholesterol accumulation depends on the SCP-2 domain of SLP-1, suggesting its role in cholesterol transfer to late endosomes .

Stomatin as a Target for Therapeutic Intervention

Given its involvement in various diseases, stomatin represents a potential target for therapeutic intervention. For instance, compounds targeting retinol-binding protein 4 (RBP4), which is linked to obesity and hepatic steatosis, have shown promise in preclinical studies .

Recombinant Stomatin

Recombinant stomatin is produced in E. coli as a single polypeptide chain . It is often fused to a His-tag at the N-terminus for purification . Recombinant human neurotrophin-4 has been used in experiments with rosette neurons .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
sto-4; Y71H9A.3/T04F8.5; Stomatin-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sto-4
Target Protein Sequence
MQRQGTVRAPCSRIVDPHQKVNYTVCGWIITIISYLVVLFTLPLSAFFCLKVVQEYERAV IFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYF RISNATVSVINVEDAARSTKLLAQTTLRNFLGTRTLAEMLSSRDAISMQMQAALDEATDP WGVKVERVEIKDVRLPIQLQRAMAAEAEAARAAGAKIIAAEGEQLASRALADAADVIATS PCAIQLRYLQTLNSISSEKNNTIIFPFPTELIAKFIQSAAA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_Y71H9A.3

STRING: 6239.Y71H9A.3.1

UniGene: Cel.452

Protein Families
Band 7/mec-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Stomatin-4 and what is its evolutionary significance?

Stomatin-4 (sto-4) belongs to the highly-conserved stomatin domain family of proteins found throughout all classes of life. This conservation suggests critical functional roles that have been maintained through evolutionary processes. The stomatin domain has been implicated in the function of various tissues and cell types, including the kidney, red blood cells, and specific neuron types, although many of the underlying mechanisms remain unresolved . When conducting evolutionary analyses of sto-4, researchers should begin with multiple sequence alignments of stomatin domain proteins across species, followed by phylogenetic tree construction to visualize conservation patterns. This approach helps establish evolutionary relationships that may provide insights into functional significance.

What model organisms are most suitable for studying sto-4 function?

Caenorhabditis elegans (C. elegans) has emerged as an excellent model organism for studying sto-4 function, particularly in relation to olfactory behaviors. This nematode offers several advantages for sto-4 research, including a fully sequenced genome, well-characterized neural circuitry, and established behavioral assays that can detect subtle phenotypic changes resulting from genetic modifications . When designing experiments with C. elegans, researchers should consider using both knockout and transgenic approaches to study sto-4 function. Knockout worms can be generated using CRISPR-Cas9 technology, while transgenic animals expressing fluorescently tagged sto-4 can help visualize protein localization and dynamics.

How should researchers prepare for chemotaxis assays when evaluating sto-4 function?

When conducting chemotaxis assays to evaluate sto-4 function in olfactory behavior, researchers should divide unseeded plates into four quadrants (two with buffer and two with odorant). The chemotaxis index is calculated as (number of animals in two odorant quadrants)/(number of animals in any of the four quadrants). Only worms that move beyond the central circle should be counted. For experiments involving sto-4 and unc-1 worms, which may exhibit uncoordinated movement, assays should be extended to 2 hours to allow sufficient time for worms to move from the origin . Researchers should stage animals at larval L4 stage and use M9 buffer for washes. A minimum of 30 animals per genotype should be tested to ensure statistical significance.

What purification strategies yield the highest purity recombinant sto-4?

Purification of recombinant sto-4 typically requires a multi-step approach. Begin with affinity chromatography using a fusion tag (His, GST, or MBP) for initial capture, followed by ion exchange chromatography to separate protein variants based on charge differences. Finally, size exclusion chromatography helps remove aggregates and achieve high purity. When working with sto-4, which may associate with membranes, consider including detergents (e.g., DDM, CHAPS, or Triton X-100) in buffers at concentrations above their critical micelle concentration to maintain protein solubility. Protein purity should be assessed by SDS-PAGE analysis, with expected purity >95% after the complete purification workflow, and verified by Western blotting using anti-sto-4 antibodies.

Purification StepBuffer CompositionExpected YieldPurity Assessment
Affinity (His-tag)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 0.05% DDM70-80% recovery>60% by SDS-PAGE
Ion Exchange50 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradient, 0.05% DDM60-70% recovery>85% by SDS-PAGE
Size Exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM90-95% recovery>95% by SDS-PAGE

How should researchers design behavioral assays to assess sto-4 function in olfaction?

When designing behavioral assays to assess sto-4 function in olfaction, researchers should implement both chemotaxis assays and "smell on a stick" tests. For the "smell on a stick" assay, stage worms to larval L4, transfer 30+ worms of each genotype to unseeded plates, and test each genotype for lack of reaction to both a clean toothpick and a toothpick with diluent (70:30 95% EtOH:H2O). Prepare a testing solution of 1:100,000 dilution of octanol in the diluent. Dip a sterile toothpick into this solution and place it just in front of a forward-moving worm. Score for positive response (moving away from the test solution) or negative response (no response). Remove tested worms to prevent resampling, and conduct assays in triplicate with n=30 worms per genotype per assay . This methodology enables quantitative assessment of subtle olfactory phenotypes in sto-4 mutants.

What are the recommended approaches for analyzing protein-protein interactions involving sto-4?

For investigating protein-protein interactions involving sto-4, researchers should employ multiple complementary techniques. Begin with co-immunoprecipitation (Co-IP) using antibodies against sto-4 or potential binding partners, followed by Western blot analysis to identify interacting proteins. For more sensitive detection, proximity ligation assays can visualize interactions in situ with subcellular resolution. Biophysical methods such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) provide quantitative binding parameters including affinity constants, stoichiometry, and binding kinetics. Additionally, yeast two-hybrid screens can identify novel interaction partners from cDNA libraries. For structural characterization of interactions, X-ray crystallography or cryo-electron microscopy of co-purified complexes provides atomic-level details of binding interfaces.

How can researchers effectively design CRISPR-Cas9 gene editing strategies for sto-4 functional studies?

When designing CRISPR-Cas9 gene editing strategies for sto-4 functional studies, researchers should first identify target sites using algorithms that score guide RNAs based on specificity and efficiency. For knockout studies, target early exons to ensure complete loss of function, while for knock-in studies (e.g., fluorescent tagging), target regions near the desired insertion site. Always design at least 3-4 different guide RNAs per target to maximize success rates. For C. elegans studies, deliver CRISPR components via microinjection into the germline. Confirm editing by sequencing and validate functional consequences through behavioral assays such as chemotaxis and "smell on a stick" tests . For subtle mutations, employ homology-directed repair with donor templates containing the desired modification flanked by ~1kb homology arms on each side.

What approaches should be used to investigate the molecular mechanisms of sto-4 in neuronal function?

To investigate molecular mechanisms of sto-4 in neuronal function, researchers should implement a multi-faceted approach combining genetic, biochemical, and electrophysiological techniques. Generate transgenic animals expressing fluorescently-tagged sto-4 to visualize subcellular localization in neurons. Conduct patch-clamp electrophysiology on neurons from wild-type and sto-4 mutant animals to assess differences in membrane properties and action potential generation. Employ calcium imaging using genetically-encoded calcium indicators (GECIs) to monitor neuronal activity in response to olfactory stimuli. Perform proteomic analysis of sto-4-containing protein complexes isolated from neuronal tissues to identify interaction partners. Complement these approaches with transcriptome analysis (RNA-seq) comparing wild-type and sto-4 mutant neurons to identify downstream effectors. This comprehensive strategy will elucidate how sto-4 contributes to neuronal signaling and olfactory behaviors.

How can researchers address issues with protein solubility when working with recombinant sto-4?

When encountering solubility issues with recombinant sto-4, researchers should first optimize expression conditions by lowering induction temperature (16-20°C), reducing inducer concentration, and extending induction time. If problems persist, modify the buffer composition by testing different pH values (typically pH 6.0-8.5), salt concentrations (150-500 mM NaCl), and adding stabilizing agents such as glycerol (5-10%) or mild detergents (0.05-0.1% DDM, CHAPS, or Triton X-100). For membrane-associated proteins like sto-4, expressing truncated versions that exclude transmembrane domains can improve solubility. Additionally, using solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin often dramatically increases soluble expression. If inclusion bodies form despite these approaches, develop refolding protocols using gradual dialysis to remove denaturants while maintaining protein stability.

What strategies can overcome inconsistent results in behavioral assays with sto-4 mutants?

To address inconsistent results in behavioral assays with sto-4 mutants, researchers should implement several standardization measures. First, ensure precise age synchronization of worms by using timed egg lays or bleaching protocols to obtain populations at identical developmental stages (L4 larval stage is recommended) . Control environmental variables by maintaining consistent temperature (20-22°C), humidity (50-60%), and illumination conditions during assays. For assays involving uncoordinated worms like sto-4 and unc-1 mutants, extend assay duration to 2 hours to allow sufficient time for movement . Increase sample sizes to at least 30 worms per condition, tested in triplicate, to improve statistical power. Include appropriate controls in each experiment: wild-type worms, known olfactory mutants, and vehicle-only conditions. Finally, blind the experimenter to genotypes during scoring to eliminate unconscious bias.

How does research on sto-4 contribute to broader understanding of sensory neurobiology?

Research on sto-4 contributes significantly to our understanding of sensory neurobiology by elucidating fundamental mechanisms of olfactory signal transduction. The stomatin domain proteins, including sto-4, appear to play conserved roles in sensory function across species . By studying how sto-4 affects olfactory behaviors in model organisms like C. elegans, researchers gain insights into how membrane protein organization influences sensory neuron function. These findings can be extrapolated to more complex nervous systems, including mammalian models, where homologous proteins may serve similar functions. Additionally, understanding sto-4's role in modulating neuronal excitability could inform research on sensory processing disorders and provide potential therapeutic targets. Researchers should consider collaborative approaches that bridge molecular, cellular, and systems neuroscience to fully contextualize sto-4 function within the broader framework of sensory biology.

What are the potential applications of sto-4 research in understanding human disease?

The study of sto-4 has potential implications for understanding several human pathologies, particularly those involving sensory dysfunction. Stomatin domain proteins have been implicated in kidney function, red blood cell biology, and neuronal signaling , suggesting that sto-4 research may provide insights into related human disorders. Researchers investigating these connections should employ comparative genomics approaches to identify human homologs of sto-4 and characterize their expression patterns in relevant tissues. Patient-derived samples can be analyzed for mutations or expression changes in these homologs, particularly in cases of idiopathic sensory disorders. Furthermore, animal models with manipulated sto-4 expression can serve as platforms for testing therapeutic interventions. This translational approach connects basic sto-4 research to potential clinical applications, highlighting the broader impact of fundamental research on membrane protein biology.

What emerging technologies will advance our understanding of sto-4 function?

Several cutting-edge technologies will significantly enhance our understanding of sto-4 function in the coming years. Cryo-electron microscopy will enable determination of high-resolution structures of sto-4 protein complexes, revealing molecular mechanisms of interaction with binding partners and membrane lipids. Advanced optogenetic and chemogenetic tools will allow precise temporal control of sto-4 expression or activity in specific neurons, enabling researchers to dissect its role in neural circuits in real-time. Single-cell transcriptomics and proteomics will identify cell type-specific effects of sto-4 modulation, providing a comprehensive view of its impact on cellular function. CRISPR-based epigenetic modulators will enable fine-tuned regulation of sto-4 expression without altering genetic sequence. Finally, microfluidic devices coupled with automated behavioral tracking will facilitate high-throughput phenotypic screening of sto-4 variants, dramatically accelerating functional characterization efforts.

How should researchers design long-term research programs to comprehensively characterize sto-4 biology?

A comprehensive long-term research program for characterizing sto-4 biology should adopt a multilevel approach spanning molecular, cellular, and behavioral analyses. Begin with detailed structural biology investigations to determine sto-4 protein structure and membrane topology. In parallel, conduct systematic proteomic studies to identify interaction partners under various physiological conditions. Develop transgenic animal models expressing modified versions of sto-4 (point mutations, domain deletions, etc.) to correlate structure with function. Implement electrophysiological recordings from neurons expressing wild-type versus mutant sto-4 to characterize effects on membrane properties and signaling. Extend behavioral analyses beyond olfaction to assess potential roles in other sensory modalities . Finally, translate findings to mammalian systems by studying homologous proteins in mouse models. This integrated approach, conducted over 5-10 years, would provide a comprehensive understanding of sto-4 biology from molecule to behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.