Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant EcfT is a transmembrane component of the ECF transporter system in Streptococcus equi subsp. equi, a pathogenic bacterium causing strangles in horses . ECF transporters consist of:

  • S-component: Substrate-binding protein (e.g., FolT, PanT).

  • ECF module: Composed of EcfT (transmembrane scaffold), EcfA, and EcfA' (ATP-binding proteins) .

This recombinant protein is expressed in Escherichia coli for experimental studies, enabling insights into substrate transport mechanisms and pathogen-host interactions .

2.1. Primary Structure

  • Amino acid sequence: The full-length protein (269 residues) includes conserved motifs critical for function . Key residues:

    • Two arginine-rich motifs (Ala-Arg-Gly) in the C-terminal region .

    • Transmembrane helices (TM1–TM6) forming a rigid six-helix bundle .

3.1. Mechanism of Action

  • Scaffold function: EcfT anchors the ECF module to S-components, enabling substrate-specific transport .

  • ATPase coupling: Cooperates with EcfA/A' to hydrolyze ATP, driving substrate translocation .

3.2. Key Interactions

Interaction PartnerFunctional Impact
S-componentBinds via hydrophobic surfaces on TM1/TM2; determines substrate specificity .
EcfA/A'Conformational changes in EcfT relay ATP hydrolysis energy to S-components .

3.3. Mutational Studies

  • Arginine residues: Replacement of conserved Arg residues (e.g., R144E, R236E) disrupts ATPase activity and complex stability .

  • Motif I/II mutations: Reduce vitamin uptake efficiency by 60–100% in Lactobacillus models .

4.1. Experimental Use

  • ELISA kits: Recombinant EcfT is commercially available for antibody detection (e.g., CSB-EP495699FMI1) .

  • In vitro reconstitution: Used to study competitive binding between S-components (e.g., FolT vs. PanT) .

Evolutionary and Pathogenic Insights

  • Clonal origin: S. equi subsp. equi evolved from S. zooepidemicus, with EcfT likely retained for micronutrient scavenging in host environments .

  • Therapeutic potential: Targeting EcfT could disrupt bacterial vitamin uptake, offering strategies against strangles .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
ecfT; SEQ_2213; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Streptococcus equi subsp. equi (strain 4047)
Target Names
ecfT
Target Protein Sequence
MDKLILGRYIPGNSIIHRLDPRSKLLAMIIYIIIIFWANNVVTNLLLLAFTLLLIFLSQI KWSFFFNGVKPMIGIILFTTLFQVFFTQGGSVLFQLGIIKITSLGLSQAILIFMRFVLII FFSTLLTLTTTPLSLSDAVEALLKPLVRFKVPAHEIGLMLSLSLRFVPTLMDDTTRIMNA QKARGVDFGEGNLIQKVKSIIPILIPLFASSFKRADALAIAMEARGYQGGDSRTKYRLLS WQLKDTLAIILVVILGIFLFCLKSPSRLT
Uniprot No.

Target Background

Function
EcfT is the transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required for the transport of various substrates.
Database Links

KEGG: seu:SEQ_2213

Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the EcfT protein and what is its role in Streptococcus equi?

EcfT (Energy-coupling factor transporter transmembrane protein) functions as a crucial component of Energy-coupling factor (ECF) transporters in prokaryotes such as Streptococcus equi. These transporters mediate the import of essential micronutrients across the cell membrane. The EcfT protein specifically serves as the transmembrane component that, together with two cytosolic ATPases (often EcfA and EcfA'), forms the ECF module. This module is responsible for powering substrate transport through ATP hydrolysis. Unlike other ABC transporters where both membrane subunits are homologous, in ECF transporters only the EcfT subunit interacts with the nucleotide-binding domains (NBDs) via two long coupling helices to transmit conformational changes from the ATP-binding site to the transmembrane region .

How is recombinant EcfT protein typically expressed and purified for research?

Recombinant EcfT protein from Streptococcus equi is typically expressed in E. coli expression systems using a His-tag fusion for simplified purification. The process involves the following methodological steps:

  • Cloning the ecfT gene (often with codon optimization) into an appropriate expression vector

  • Transformation into an E. coli expression strain (commonly BL21(DE3))

  • Culture and induction of protein expression

  • Cell lysis and membrane fraction isolation

  • Solubilization using appropriate detergents

  • Purification via His-tag affinity chromatography

  • Further purification steps (e.g., size exclusion chromatography) if required

  • Concentration and buffer exchange

  • Storage as a lyophilized powder or in solution with glycerol

The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE and can be reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the recommended storage conditions for recombinant EcfT protein?

For optimal stability and activity retention of recombinant EcfT protein from Streptococcus equi, the following storage conditions are recommended:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot the solution to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this may lead to protein denaturation and activity loss

How do S-components interact with the ECF module in ECF transporters, and what methodologies can be used to study these dynamics?

ECF transporters exhibit a unique mechanism wherein different S-components can compete for docking onto the same ECF module in a process critical to their transport function. This dynamic interaction can be studied using the following methodological approaches:

  • Liposome reconstitution systems: Co-reconstitution of multiple ECF transporters (e.g., ECF-FolT2 and ECF-PanT) into proteoliposomes allows for direct observation of S-component exchange during active transport. This approach has revealed that association and dissociation of S-components is an essential step in the transport mechanism of group II ECF transporters.

  • Transport kinetics assays: By measuring initial rates of substrate uptake into proteoliposomes at varying substrate concentrations, researchers can determine apparent Km values. These are typically in the nanomolar range for vitamins like pantothenate and folate, consistent with ECF transporters' role as high-affinity micronutrient scavengers.

  • Competition experiments: When incomplete or inactive transporters (e.g., S-component alone or S-component with mutated ECF module) are co-reconstituted with fully active ECF complexes of a different specificity, transport of both substrates can occur due to S-component exchange. This confirms the dynamic nature of the interactions.

  • ATP dependence studies: The sigmoidal relationship between ATP concentration and transport rates (with Km values in the mM range) reveals cooperativity between ATP binding sites, which differs from the hyperbolic relationship observed in direct ATPase assays.

The experimental evidence shows that S-components sharing as little as 21.5% sequence identity can dynamically associate with and dissociate from a common ECF module, explaining how different substrates can be transported by sharing the same energy-coupling machinery .

What structural changes occur during the transport cycle of ECF transporters containing EcfT?

The transport cycle of ECF transporters involves significant conformational changes in the EcfT protein and associated components. Based on crystallographic and functional studies, the following sequence of structural transitions occurs:

  • Initial state: The S-component (substrate-binding protein) is in a solitary form in the membrane with the substrate-binding site facing the extracellular environment.

  • Substrate binding: Upon binding of the substrate (e.g., folate or pantothenate), the S-component undergoes conformational changes that prepare it for docking with the ECF module.

  • Toppling mechanism: The S-component "topples" in the membrane upon interaction with the ECF module, resulting in a 90° rotation that exposes the substrate-binding site to the cytoplasm.

  • ATP binding and hydrolysis: ATP binding to the ATPase domains (EcfA and EcfA') triggers conformational changes that are transmitted via the coupling helices of EcfT to the S-component.

  • Substrate release: The conformational changes lead to substrate release into the cytoplasm.

  • Reset: ATP hydrolysis resets the system, allowing the S-component to dissociate or be replaced by another S-component.

Comparison of crystal structures of different ECF transporters (e.g., ECF-PanT and ECF-FolT2) reveals that larger conformational changes occur upon binding of folate than pantothenate, which may explain kinetic differences in their transport. These structural insights are crucial for understanding the molecular basis of substrate specificity and transport efficiency .

What are the challenges in obtaining functional recombinant EcfT protein, and how can they be addressed?

Obtaining functional recombinant EcfT protein presents several challenges that require specific methodological approaches:

  • Membrane protein expression: As an integral membrane protein, EcfT is difficult to express in soluble form. This can be addressed by:

    • Optimizing codon usage for the expression host

    • Using specialized E. coli strains designed for membrane protein expression

    • Testing alternative fusion tags (His, FLAG, MBP, GST) to improve solubility

    • Exploring different expression systems (E. coli, yeast, insect cells) to identify optimal conditions

  • Protein stability: EcfT may be unstable when removed from its native membrane environment. Solutions include:

    • Adding stabilizing agents during purification (specific lipids, detergents)

    • Using mild solubilization conditions to maintain native-like folding

    • Including trehalose (6%) in storage buffers to enhance stability

    • Reconstituting the protein into nanodiscs or liposomes to mimic the membrane environment

  • Functional reconstitution: Obtaining functionally active EcfT requires proper assembly with partner proteins. Approaches include:

    • Co-expression with other ECF components

    • Sequential or simultaneous reconstitution into liposomes

    • Validating proper insertion orientation in liposomes

    • Verifying ATP-dependent transport activity

  • Quality control: Ensuring consistency across batches through:

    • Rigorous SDS-PAGE analysis (>90% purity)

    • Activity assays measuring substrate transport

    • Thermal stability assessments

    • Circular dichroism to verify secondary structure integrity

How can researchers differentiate between substrate specificity of different S-components that interact with the same ECF module?

Differentiating substrate specificity of S-components that share the same ECF module requires sophisticated methodological approaches:

  • Competition assays in reconstituted systems:

    • Co-reconstitute multiple complete ECF transporters (e.g., ECF-FolT2 and ECF-PanT) into proteoliposomes

    • Measure transport of one substrate in the presence of varying concentrations of a competing substrate

    • Analyze the pattern of inhibition to determine whether competition occurs at the level of the S-component, the ECF module, or both

  • Kinetic characterization:

    • Determine apparent Km values for different substrates

    • Compare transport rates (Vmax) under standardized conditions

    • Analyze the relationship between substrate concentration and transport rate (hyperbolic for non-cooperative systems)

    • Assess the ATP dependence of transport (sigmoidal relationships suggest cooperativity)

  • Structural analysis:

    • Compare crystal structures of ECF transporters with different S-components

    • Identify structural determinants of substrate binding

    • Analyze conformational changes upon substrate binding

    • Use mutagenesis to validate the role of specific residues in substrate specificity

Experimental data has shown that different S-components can have significantly different kinetic properties despite sharing the same ECF module. For example, FolT2 and PanT (which share only 21.5% sequence identity) exhibit different apparent association rates with their respective substrates, likely due to the larger conformational changes required for folate binding compared to pantothenate binding .

How can researchers design experiments to study the role of EcfT in bacterial survival under nutrient-limited conditions?

Designing experiments to investigate EcfT's role in bacterial survival under nutrient limitation requires a multifaceted approach:

  • Generation of genetic tools:

    • Create an ecfT knockout strain using homologous recombination or CRISPR-Cas9

    • Develop complementation strains expressing wild-type or mutant ecfT under controlled promoters

    • Construct fluorescent protein fusions for localization studies

  • Growth and survival assays:

    • Compare growth curves of wild-type, ΔecfT, and complemented strains in media with varying concentrations of micronutrients

    • Perform competition assays by co-culturing tagged wild-type and mutant strains

    • Conduct long-term survival experiments in stationary phase

    • Use a chemostat to maintain precise control over nutrient availability

  • Transport activity measurements:

    • Measure uptake of radiolabeled substrates in whole cells

    • Quantify intracellular accumulation of vitamins and micronutrients

    • Compare transport kinetics between wild-type and mutant strains

  • Environmental stress responses:

    • Examine survival under different environmental conditions that might be encountered by Streptococcus equi (varying temperature, pH, etc.)

    • Test survival in conditions mimicking the host environment (equine respiratory mucosa)

    • Assess survival in environments with different temporal patterns of nutrient availability

  • Interaction with host factors:

    • Investigate whether host-derived molecules affect EcfT function

    • Determine if EcfT contributes to evasion of host nutritional immunity

    • Assess whether EcfT affects susceptibility to antimicrobial peptides

These approaches would help elucidate whether EcfT-mediated micronutrient acquisition is critical for the environmental persistence of Streptococcus equi, which has been shown to survive for extended periods (up to 34 days in wet environments during winter conditions) .

What controls should be included when studying ATP-dependent transport by recombinant EcfT-containing complexes?

When investigating ATP-dependent transport by EcfT-containing complexes, the following controls are essential for rigorous experimental design:

  • ATP-related controls:

    • ATP-free conditions to establish baseline/non-specific transport

    • Non-hydrolyzable ATP analogs (e.g., AMP-PNP) to distinguish between ATP binding and hydrolysis effects

    • Various ATP concentrations to establish dose-response relationships

    • ATP regeneration system (creatine phosphate/creatine kinase) for long-duration experiments

    • ATPase inhibitors to confirm specificity

  • Protein component controls:

    • S-component-only proteoliposomes to assess substrate binding without transport

    • ECF module-only proteoliposomes to confirm no transport without S-components

    • Inactive mutants (e.g., Walker A/B motif mutations in ATPase domains)

    • Heterologous S-components to test specificity of interactions

  • Reconstitution controls:

    • Empty liposomes to assess background leakage/binding

    • Quantification of protein incorporation efficiency

    • Assessment of protein orientation in liposomes

    • Comparison of different lipid compositions

    • Addition of ionophores or valinomycin/nigericin to dissipate potential gradients

  • Substrate controls:

    • Structurally related non-substrate molecules

    • Competitive inhibitors

    • Range of substrate concentrations

    • Control for substrate degradation during experiment

  • Environmental controls:

    • Temperature series experiments

    • pH dependency tests

    • Ionic strength variations

    • Presence/absence of divalent cations (Mg²⁺, Ca²⁺)

These controls help distinguish specific ATP-dependent transport from non-specific effects and provide insights into the molecular mechanism of transport. When comparing different S-components competing for the same ECF module, additional controls including pre-loading of specific substrates can help elucidate the dynamic interplay between components .

How can researchers optimize reconstitution of EcfT into proteoliposomes for functional studies?

Optimizing the reconstitution of EcfT into proteoliposomes for functional studies requires careful consideration of multiple parameters:

  • Lipid composition optimization:

    • Test various lipid compositions (e.g., POPC, POPE, POPG, cardiolipin)

    • Determine optimal protein-to-lipid ratios (typically 1:100 to 1:500 w/w)

    • Consider incorporating native bacterial lipids

    • Evaluate the effect of lipid phase transitions on activity

    • Optimize cholesterol content if applicable

  • Reconstitution method selection:

    • Compare detergent-mediated reconstitution methods (detergent removal by dialysis, Bio-Beads, or cyclodextrin)

    • Test direct incorporation during liposome formation

    • Evaluate freeze-thaw cycles to improve protein incorporation

    • Assess the impact of extrusion or sonication on proteoliposome size and homogeneity

    • Consider reconstitution into nanodiscs for single-molecule studies

  • Buffer optimization:

    • Test different pH values for reconstitution

    • Optimize ionic strength and specific ion requirements

    • Determine optimal glycerol concentration

    • Evaluate the need for stabilizing agents (trehalose, sucrose)

    • Test the impact of ATP presence during reconstitution

  • Co-reconstitution strategies:

    • Sequential addition vs. simultaneous reconstitution of components

    • Pre-formation of protein complexes before reconstitution

    • Optimization of component stoichiometry

    • Control of orientation by creating asymmetric conditions during reconstitution

  • Quality control procedures:

    • Measure protein incorporation efficiency by density gradient centrifugation

    • Assess protein orientation using protease protection assays

    • Evaluate size distribution using dynamic light scattering

    • Confirm functional activity via transport assays

    • Verify structural integrity using circular dichroism or fluorescence spectroscopy

Researchers have successfully used such optimization approaches to reconstitute ECF transporters that maintain their ability to transport substrates with Km values in the nanomolar range, confirming that the reconstituted systems retain the high-affinity characteristics observed in vivo .

What are common reasons for loss of activity in purified recombinant EcfT protein, and how can these issues be addressed?

Loss of activity in purified recombinant EcfT protein can occur for various reasons, each requiring specific remediation strategies:

  • Protein denaturation during purification:

    • Problem: Harsh conditions during membrane protein extraction and purification

    • Solutions:

      • Use milder detergents (DDM, LMNG) instead of harsh ones (SDS, Triton X-100)

      • Include stabilizing agents (glycerol, specific lipids) throughout purification

      • Maintain cold temperatures during all steps

      • Consider native purification methods that preserve protein-protein interactions

  • Oxidation of critical cysteine residues:

    • Problem: Oxidation of free thiols affecting protein folding or activity

    • Solutions:

      • Include reducing agents (DTT, β-mercaptoethanol) in buffers

      • Work under nitrogen atmosphere for sensitive preparations

      • Consider site-directed mutagenesis of non-essential cysteines

      • Add EDTA to chelate metal ions that catalyze oxidation

  • Improper reconstitution into membranes:

    • Problem: Incorrect orientation or aggregation during proteoliposome formation

    • Solutions:

      • Optimize detergent:lipid:protein ratios

      • Use controlled, gradual detergent removal methods

      • Verify protein orientation using protease protection assays

      • Include native or native-like lipids in reconstitution mixtures

  • Loss of essential cofactors or lipids:

    • Problem: Removal of stabilizing factors during purification

    • Solutions:

      • Supplement purification buffers with essential ions (Mg²⁺)

      • Add back specific lipids identified as stabilizers

      • Avoid excessive washing steps that may remove bound cofactors

      • Consider co-purification with known interaction partners

  • Storage-related degradation:

    • Problem: Protein degradation during storage

    • Solutions:

      • Store as aliquots to avoid repeated freeze-thaw cycles

      • Add 5-50% glycerol to storage buffer

      • Store at -80°C rather than -20°C for long-term storage

      • Consider lyophilization for maximum stability

      • Limit working aliquot storage at 4°C to one week maximum

How can researchers troubleshoot low yield or poor solubility when expressing recombinant EcfT?

When encountering low yield or poor solubility of recombinant EcfT, researchers can implement the following troubleshooting strategies:

  • Expression system optimization:

    • Problem: Suboptimal expression system for membrane protein

    • Solutions:

      • Test multiple E. coli strains (BL21(DE3), C41/C43(DE3), Rosetta-GAMI)

      • Evaluate alternative expression systems (yeast, insect cells)

      • Try different fusion tags (His, MBP, GST, SUMO) to enhance solubility

      • Consider specialized membrane protein expression vectors

  • Expression conditions refinement:

    • Problem: Formation of inclusion bodies or toxic accumulation

    • Solutions:

      • Reduce induction temperature (16-25°C instead of 37°C)

      • Decrease inducer concentration (0.1-0.5 mM IPTG instead of 1 mM)

      • Extend expression time (overnight vs. 3-4 hours)

      • Use auto-induction media for gentler expression kinetics

      • Add membrane-stabilizing components (glycerol, specific lipids)

  • Codon optimization strategies:

    • Problem: Inefficient translation due to rare codons

    • Solutions:

      • Perform codon optimization for the expression host

      • Use strains supplying rare tRNAs (Rosetta)

      • Reduce secondary structure in mRNA near the start codon

      • Optimize GC content to match host preferences

  • Solubilization method improvement:

    • Problem: Inefficient extraction from membranes

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, CHAPS, digitonin)

      • Test different detergent concentrations

      • Optimize solubilization time and temperature

      • Add specific lipids during solubilization

      • Try detergent mixtures rather than single detergents

  • Co-expression approaches:

    • Problem: Instability without partner proteins

    • Solutions:

      • Co-express with other ECF components

      • Include molecular chaperones (GroEL/ES, DnaK/J)

      • Consider co-expression with specific lipid-modifying enzymes

      • Use bacterial strains with elevated membrane production capacity

These strategies can significantly improve the yield and solubility of this challenging membrane protein. Researchers should implement a systematic approach, testing multiple variables in parallel to identify optimal conditions for their specific construct .

How should transport kinetics data for EcfT-containing ECF transporters be analyzed to distinguish between different mechanistic models?

Analyzing transport kinetics data for EcfT-containing ECF transporters requires sophisticated approaches to distinguish between competing mechanistic models:

  • Initial rate determination:

    • Establish truly linear initial rates by sampling at multiple early time points

    • Use rapid filtration or fluorescence-based real-time assays for accurate measurement

    • Plot initial rates versus substrate concentration to determine kinetic parameters

    • Perform replicate measurements to establish statistical confidence

  • Kinetic model fitting:

    • Compare goodness-of-fit for different kinetic models:

      • Michaelis-Menten (hyperbolic) model

      • Sigmoidal (cooperative) models (Hill equation)

      • Two-site models (if multiple binding sites are present)

    • Use statistical criteria (AIC, BIC) to select the most appropriate model

    • Determine whether the data support cooperativity by analyzing Hill coefficients

  • Distinguishing transport mechanisms:

    • Compare ATP dependence (sigmoidal) with substrate dependence (hyperbolic)

    • Analyze the effect of competing substrates (competitive vs. non-competitive patterns)

    • Examine the impact of mutations in different components on kinetic parameters

    • Use pre-steady-state kinetics to identify rate-limiting steps

  • S-component exchange analysis:

    • Design experiments to specifically test the "dynamic interaction model":

      • Reconstitute different combinations of complete and incomplete transporters

      • Measure transport of one substrate in the presence of the other S-component

      • Analyze how transport rates change when components are mixed

    • Use these data to establish whether S-component exchange is part of the mechanism

  • Global data analysis:

    • Integrate data from multiple experimental approaches:

      • Equilibrium binding studies

      • Transport kinetics

      • ATPase activity measurements

      • Structural information

    • Develop comprehensive kinetic models that account for all observed behaviors

This analytical framework has revealed important mechanistic insights, such as the observation that substrate transport by ECF transporters shows hyperbolic dependence on substrate concentration (indicating a single binding site) but sigmoidal dependence on ATP concentration (indicating cooperativity between ATP binding sites). These findings suggest a complex mechanism involving coordinated conformational changes during the transport cycle .

What are the most informative experimental parameters to measure when characterizing novel ECF transporters containing EcfT?

When characterizing novel ECF transporters containing EcfT, researchers should focus on measuring the following key experimental parameters:

  • Substrate specificity and affinity:

    • Apparent Km values for various potential substrates

    • Transport rates (Vmax) for each substrate

    • Substrate concentration ranges that yield measurable transport

    • Competitive inhibition profiles with structural analogs

    • Binding affinities (Kd) determined through direct binding assays

  • ATP dependence characteristics:

    • ATP concentration dependence curve (Km and Hill coefficient)

    • Comparison of ATPase activity versus transport activity

    • Effect of non-hydrolyzable ATP analogs

    • ATP:substrate stoichiometry

    • Energy efficiency (ATP molecules consumed per substrate transported)

  • Component interaction parameters:

    • S-component:ECF module binding affinities

    • Exchange rates between different S-components

    • Effect of mutations at interaction interfaces

    • Competition between S-components for the ECF module

    • Cooperativity in assembly/disassembly

  • Structural dynamics:

    • Conformational changes upon substrate binding

    • Toppling mechanism dynamics

    • Effects of membrane environment on conformational changes

    • Protein stability in different conformational states

    • Role of specific domains in the transport mechanism

  • Regulatory aspects:

    • Effect of cellular energy status on transport activity

    • Feedback inhibition by transported substrates

    • Impact of membrane potential on transport rates

    • Regulation by other cellular factors

    • Substrate-induced changes in protein-protein interactions

The integrative analysis of these parameters has proven highly informative in previous studies, revealing that ECF transporters exhibit high-affinity substrate binding (nanomolar Km values), cooperative ATP binding (sigmoidal kinetics), and dynamic S-component exchange as part of their transport mechanism. These characteristics distinguish them from other ABC transporters and explain their efficient function as micronutrient scavengers under nutrient-limited conditions .

What emerging technologies might enhance our understanding of EcfT function in bacterial physiology?

Several cutting-edge technologies hold promise for advancing our understanding of EcfT function in bacterial physiology:

  • Single-molecule techniques:

    • Single-molecule FRET to monitor real-time conformational changes during transport

    • High-speed atomic force microscopy to visualize dynamic interactions between components

    • Nanodiscs combined with single-particle cryo-EM for structural studies in membrane environments

    • Optical tweezers to measure forces involved in conformational changes

    • Single-molecule tracking in live cells to observe diffusion and clustering behavior

  • Advanced structural methods:

    • Time-resolved crystallography to capture transient intermediates

    • Cryo-electron tomography of intact bacterial cells to visualize ECF transporters in native membranes

    • Integrative structural biology combining multiple data sources (X-ray, cryo-EM, NMR, SAXS)

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein regions

    • Microcrystal electron diffraction for difficult-to-crystallize states

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand regulatory networks

    • Flux balance analysis to quantify contributions to cellular metabolism

    • Machine learning to identify patterns in large-scale datasets

    • Network analysis to map interactions with other cellular systems

    • Bacterial cytological profiling to characterize phenotypic responses

  • Genetic tools:

    • CRISPR interference for tunable gene expression modulation

    • Optogenetic control of ECF transporter components

    • Synthetic biology approaches to engineer novel substrate specificities

    • In vivo proximity labeling to identify interaction partners

    • Deep mutational scanning to map sequence-function relationships

  • In vivo imaging:

    • Fluorescent biosensors for real-time monitoring of transport activity

    • Super-resolution microscopy to visualize nanoscale organization

    • Live-cell imaging under changing nutrient conditions

    • Correlative light and electron microscopy to link function with ultrastructure

    • Microfluidics combined with live imaging to control microenvironments

These technologies, especially when used in combination, have the potential to transform our understanding of how EcfT-containing ECF transporters function in bacterial physiology, particularly in the context of nutrient acquisition strategies in competitive environments like those encountered by Streptococcus equi during infection or environmental persistence .

How might understanding EcfT function contribute to developing new strategies against Streptococcus equi infections?

Understanding EcfT function in Streptococcus equi could lead to several innovative therapeutic strategies:

  • Novel antimicrobial development:

    • Rational design of ECF transporter inhibitors targeting the unique EcfT structure

    • Development of substrate analogs that bind but are not transported

    • Identification of compounds that disrupt S-component interactions with the ECF module

    • Design of ATP-competitive inhibitors specific to the ATPase domains of ECF transporters

    • Creation of molecules that lock the transporter in non-functional conformations

  • Nutrient-restriction strategies:

    • Design of chelators specific to essential micronutrients transported by ECF systems

    • Engineering of host proteins to sequester key nutrients more effectively

    • Development of probiotics that compete for essential nutrients

    • Creation of vaccines that generate antibodies against S-components

    • Design of decoy substrates that occupy transporters without providing nutritional benefit

  • Targeted delivery systems:

    • Exploitation of ECF transporters to deliver antimicrobial compounds

    • Development of "Trojan horse" strategies using modified substrates linked to antimicrobials

    • Creation of nanoparticles recognized by S-components for targeted drug delivery

    • Engineering of bacteriophages to target bacteria expressing specific ECF transporters

    • Design of immunotherapies targeting surface-exposed regions of ECF components

  • Environmental control measures:

    • Development of surface disinfectants specifically targeting ECF-dependent nutrient acquisition

    • Engineering of materials that release ECF inhibitors in equine facilities

    • Creation of environmental treatments that accelerate bacterial death under nutrient limitation

    • Design of diagnostic tools to detect viable Streptococcus equi in environmental samples

    • Implementation of management practices based on understanding environmental survival kinetics

  • Combination therapies:

    • Synergistic approaches combining ECF inhibitors with traditional antibiotics

    • Dual-targeting of multiple nutrient acquisition systems

    • Sequential therapies that first block nutrient acquisition then deliver antimicrobials

    • Host-directed therapies that enhance nutritional immunity while targeting bacterial transporters

    • Immunomodulatory approaches combined with transporter inhibition

Understanding the environmental survival capabilities of Streptococcus equi (up to 34 days in wet conditions during winter) highlights the importance of targeting nutrient acquisition systems for both therapeutic and preventive strategies. The essential nature of ECF transporters for micronutrient acquisition makes them attractive targets for novel antimicrobial approaches, potentially circumventing existing resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.