Recombinant Streptococcus equi subsp. zooepidemicus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Purification Parameters

Recombinant atpF is synthesized in bacterial systems (likely E. coli, though not explicitly stated) with unspecified tags. While commercial providers emphasize high-purity (>85% SDS-PAGE in analogous products ), specific purification protocols for this subunit remain undisclosed. Available quantities include 50 µg, with custom orders possible .

Role in ATP Synthesis

As part of the F₀F₁-ATP synthase, subunit b anchors the F₀ sector to the membrane and coordinates proton flow. In Streptococcus equi, this process sustains cellular energy demands, particularly during infection.

Research Applications

Despite commercial availability, peer-reviewed studies directly investigating recombinant atpF are absent in the provided sources. Potential applications include:

  1. Structural Biology: Elucidating subunit interactions in F₀F₁-ATP synthase.

  2. Antimicrobial Development: Targeting proton translocation to disrupt bacterial bioenergetics.

  3. Vaccine Design: Evaluating subunit b as a candidate antigen (analogous to other S. equi proteins ).

Research Gaps and Limitations

Current literature focuses on other S. equi subsp. zooepidemicus proteins, such as nucleases (e.g., ENuc, 5Nuc) and adhesins (e.g., FNZ, SFS) . For atpF, critical gaps include:

  • Mechanistic Studies: No data on proton translocation rates or subunit assembly.

  • Pathogenic Relevance: Unexplored role in host-pathogen interactions.

  • Therapeutic Targets: Lack of inhibitors or binding partners identified.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; Sez_0794; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Target Names
atpF
Target Protein Sequence
MSVTIGELIGNFILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQ QLEKEGQANLEASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSE AISAVKTEMSDLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Database Links

KEGG: sez:Sez_0794

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) and what role does it play in S. zooepidemicus?

ATP synthase subunit b (atpF) is a critical component of the F₁F₀ ATP synthase complex, which is responsible for ATP production through oxidative phosphorylation in bacteria. In S. zooepidemicus, as in other bacteria, subunit b likely serves as part of the peripheral stalk that connects the membrane-embedded F₀ portion to the catalytic F₁ portion of the ATP synthase complex.

The peripheral stalk functions as a stator that prevents the F₁ subcomplex from rotating with the central rotor during ATP synthesis. Based on comparative studies with other organisms, the ATP synthase in S. zooepidemicus likely contributes significantly to energy production, which is essential for various cellular processes including growth and virulence factor production .

How conserved is the atpF gene sequence across bacterial species compared to S. zooepidemicus?

ATP synthase subunit b shows varying degrees of conservation across bacterial species. While the search results don't provide specific information about sequence conservation in S. zooepidemicus atpF, studies in other organisms indicate that ATP synthase subunit b can be highly divergent while maintaining structural and functional similarities.

For instance, in Trypanosoma brucei, a 17 kDa protein (Tb927.8.3070) was identified that shows structural similarities to ATP synthase subunit b from other species despite low sequence identity. This protein showed similarity to the spinach chloroplast subunit atpF, yeast subunit ATP4, and bacterial atpF subunits from Mycobacteria and Bacillus . This suggests that even with low sequence conservation, the structural features necessary for function may be preserved across diverse species.

What structural features characterize ATP synthase subunit b in bacteria?

ATP synthase subunit b typically contains:

  • An N-terminal transmembrane domain (TMD) that anchors the protein in the membrane

  • A C-terminal domain that extends into the cytoplasm and interacts with other subunits of the peripheral stalk and the F₁ portion

In the case of T. brucei's divergent subunit b-like protein, structural analysis revealed similarities to other ATP synthase subunit b proteins in the region encompassing the transmembrane domain and approximately 60 amino acids of the C-terminal flanking sequence . This suggests that despite sequence divergence, key structural features are preserved across species.

The typical bacterial ATP synthase subunit b forms a right-handed coiled-coil dimer that extends from the membrane to the F₁ portion. This structure is critical for maintaining the stability of the entire ATP synthase complex and ensuring efficient energy conversion.

What experimental approaches are most effective for studying the function of recombinant S. zooepidemicus ATP synthase subunit b?

Based on methodologies described in related research, several approaches can be effective for studying recombinant S. zooepidemicus ATP synthase subunit b:

  • Gene deletion and complementation studies: Creating markerless gene-deletion mutants followed by phenotypic characterization can reveal the essentiality and function of atpF. This approach has been successfully used for other genes in S. zooepidemicus .

  • Protein-protein interaction studies: Pull-down experiments and native PAGE analysis can identify proteins that interact with ATP synthase subunit b and its role in complex assembly. For example, in T. brucei, tagged protein pull-down experiments successfully identified associations with other ATP synthase components .

  • In organello ATP production assays: These can measure the impact of atpF manipulation on ATP synthesis capacity. Such assays have been used to demonstrate the effects of other ATP synthase subunit depletions on oxidative phosphorylation .

  • Blue native PAGE (BN-PAGE): This technique can assess the impact of atpF manipulation on the assembly and stability of the ATP synthase complex. In T. brucei, BN-PAGE followed by immunoblotting revealed that depletion of a subunit b-like protein decreased the levels of F₁F₀ ATP synthase dimer and monomer .

  • Structural homology analysis: Computational methods like HHpred algorithm, which compares profile hidden Markov models, can identify structural similarities between divergent proteins, as demonstrated in the identification of a potential subunit b in T. brucei .

What is the relationship between ATP synthase function and virulence in S. zooepidemicus?

While the search results don't directly address the relationship between ATP synthase and virulence in S. zooepidemicus, studies in related pathogens suggest important connections. ATP production is essential for multiple virulence mechanisms, including:

  • Energy for toxin production: Adequate ATP levels are required for the synthesis and secretion of virulence factors.

  • Adaptation to host environments: ATP synthase function may be critical for adapting to changing energy requirements during infection.

  • Stress response: Energy production is crucial for responding to host immune defenses and environmental stresses.

  • Biofilm formation: ATP availability may influence the ability to form biofilms, a common virulence mechanism.

Research in S. zooepidemicus has shown that metabolic engineering approaches can significantly affect growth characteristics , which could indirectly impact virulence. Further studies specifically targeting atpF would help elucidate its role in S. zooepidemicus pathogenicity.

What genetic engineering approaches can be used to study atpF function in S. zooepidemicus?

Several genetic engineering approaches can be employed to study atpF function in S. zooepidemicus:

  • Markerless gene deletion system: This approach has been successfully developed for S. zooepidemicus and enables the deletion of specific genes without leaving antibiotic resistance markers. The method involves:

    • Amplification of upstream and downstream fragments of the target gene

    • Joining fragments by splicing overextension (SOE) PCR

    • Cloning into a suicide vector (e.g., pSET4s::sacB)

    • Two-step selection process using antibiotics and sucrose resistance

  • Controlled gene expression systems:

    • Overexpression using plasmid vectors like pLH243 (a modified pSET4S vector)

    • Expression of the gene under its native promoter or inducible promoters

    • This approach has been used for genes like scrA and scrB in S. zooepidemicus

  • RNA interference (RNAi): While not specifically mentioned for S. zooepidemicus, RNAi approaches have been used to study ATP synthase components in other organisms like T. brucei .

  • Complementation studies: Reintroducing the wild-type gene or modified versions to deletion mutants to confirm phenotypes and study structure-function relationships.

How can one assess the functionality of recombinant ATP synthase subunit b in vitro?

Assessing the functionality of recombinant ATP synthase subunit b can be accomplished through several experimental approaches:

  • In organello ATP production assays: Using digitonin-extracted crude mitochondrial fractions to measure ATP production capacity. This method was used to demonstrate that depletion of a subunit b-like protein in T. brucei caused a significant decrease in succinate-mediated ATP production .

  • Blue native PAGE (BN-PAGE) analysis: This technique can assess the integration of recombinant subunit b into the ATP synthase complex. In T. brucei, BN-PAGE with subsequent immunoblot analysis showed that depletion of a subunit b-like protein decreased the levels of F₁F₀ dimer and monomer .

  • Membrane potential (ΔΨm) measurements: Since ATP synthase function is linked to membrane potential, fluorescent dyes or electrochemical methods can be used to assess the impact of atpF manipulation. Depletion of ATP synthase components in T. brucei affected membrane potential maintenance .

  • SILAC-MS approach: This quantitative mass spectrometry method can determine how manipulation of atpF affects the abundance of other ATP synthase subunits. In T. brucei, this approach revealed that knockdown of a subunit b-like protein selectively depleted F₀ ATP synthase subunits while F₁ subunits remained unaffected .

What are the optimal conditions for expressing and purifying recombinant S. zooepidemicus ATP synthase subunit b?

Based on general practices for membrane proteins and information from related research, the following conditions may be optimal for expressing and purifying recombinant S. zooepidemicus ATP synthase subunit b:

Expression systems:

  • E. coli expression systems: BL21(DE3) or C41(DE3)/C43(DE3) strains (the latter specifically designed for membrane proteins)

  • Homologous expression: Using S. zooepidemicus itself with appropriate vectors like pLH243

Expression conditions:

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Induction: Mild induction conditions using lower concentrations of inducer

  • Media supplements: Addition of glycine or sucrose may stabilize membrane proteins

Purification strategy:

  • Membrane isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG)

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for final purification

Buffer considerations:

  • pH 7.0-8.0 (physiological range)

  • Presence of glycerol (10-20%) for stability

  • Inclusion of appropriate detergent at concentrations above CMC

  • Addition of lipids to maintain native-like environment

How can understanding S. zooepidemicus ATP synthase inform metabolic engineering strategies?

Understanding the ATP synthase complex in S. zooepidemicus can inform metabolic engineering strategies in several ways:

  • Energy optimization: Manipulating ATP synthase activity could redirect energy flux toward desired metabolic pathways. Research has shown that overexpression of NADH oxidase in S. zooepidemicus increased ATP levels by 33% and biomass by 15% , demonstrating the potential for metabolic engineering approaches targeting energy production.

  • Growth and productivity balance: Engineering ATP production pathways could help balance growth and secondary metabolite production. In S. zooepidemicus, optimization of metabolism has been explored for improving hyaluronic acid (HA) production .

  • Stress tolerance improvement: ATP synthase function is critical for stress response, so engineering this complex could potentially improve bacterial tolerance to process conditions.

  • Targeting rate-limiting steps: Identifying bottlenecks in energy metabolism can guide targeted interventions. Limited knowledge of gene function and physiology of S. zooepidemicus has hindered metabolic engineering efforts, but the completion of genome sequences and development of genetic tools are enabling new approaches .

The table below summarizes potential metabolic engineering targets related to ATP production in S. zooepidemicus:

TargetStrategyExpected OutcomeResearch Status
NADH oxidaseOverexpression33% increase in ATP, 15% increase in biomassDemonstrated
ATP synthase subunitsOptimization of expressionBalanced energy productionRequires further research
Carbon fluxRedirecting through genetic modificationsImproved precursor supplyPartial success reported
Sucrose metabolism genesDeletion/overexpressionAltered growth and metabolismscrB essential for growth

What role might ATP synthase subunit b play in antibiotic resistance or as a drug target?

ATP synthase components, including subunit b, represent potential targets for antimicrobial development or may play roles in antibiotic resistance:

  • Essential function: As a component of the ATP synthase complex, subunit b is likely essential for bacterial viability, making it a potential antibiotic target. Research on ATP synthase components in other bacteria has shown their critical role in growth and survival.

  • Structural uniqueness: If S. zooepidemicus ATP synthase subunit b possesses unique structural features compared to human counterparts, these differences could be exploited for selective targeting. The research on T. brucei showed significant divergence in ATP synthase subunit b structure while maintaining function , suggesting bacterial ATP synthase components may have unique features.

  • Resistance mechanisms: Changes in ATP synthase function could potentially contribute to antibiotic resistance by altering membrane potential or energy-dependent drug efflux systems.

  • Compensatory mechanisms: Understanding how bacteria compensate for reduced ATP synthase function could reveal new resistance mechanisms or additional drug targets.

Future research should explore the specific structural features of S. zooepidemicus ATP synthase subunit b, its essentiality for growth and virulence, and potential inhibitors that could selectively target this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.