Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein Diacylglyceryl Transferase (lgt) is a recombinant protein derived from the bacterium Streptococcus equi subsp. zooepidemicus. This enzyme plays a crucial role in the lipid modification pathway of bacterial lipoproteins, which are essential for bacterial virulence and survival. The lgt enzyme catalyzes the transfer of a diacylglycerol moiety from membrane phospholipids onto a cysteine residue in the signal peptide of prolipoproteins, facilitating their maturation and anchoring to the bacterial membrane .

Function and Importance of lgt

The lgt enzyme is vital for the initial step in lipoprotein modification. Lipoproteins are involved in various bacterial processes, including nutrient uptake, cell signaling, and virulence factor expression. In gram-positive bacteria like Streptococcus equi, the lipid modification pathway is critical for the proper functioning of these proteins. Mutations in the lgt gene can lead to attenuated virulence, as seen in other pathogens where lgt mutants exhibit reduced ability to cause disease .

Characteristics of Recombinant lgt

The recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein Diacylglyceryl Transferase (lgt) is produced using an in vitro E. coli expression system or yeast for partial constructs . Key characteristics include:

  • Sequence: The protein sequence is well-defined, with specific motifs necessary for its enzymatic activity .

  • Expression Region: The full-length protein consists of 259 amino acids .

  • Storage Conditions: It is recommended to store the protein at -20°C or -80°C to maintain stability .

  • Purity and Tagging: The protein is often tagged with an N-terminal 10xHis-tag for purification purposes .

Research Findings and Applications

Research on the lgt enzyme has highlighted its role in bacterial pathogenesis. Studies have shown that mutations affecting the lipid modification pathway can significantly reduce bacterial virulence. For instance, in Streptococcus equi, mutations in the lgt gene result in attenuated strains that are less capable of causing disease in animal models .

Table: Characteristics of Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein Diacylglyceryl Transferase (lgt)

CharacteristicDescription
Expression SystemE. coli or Yeast
Sequence LengthFull-length: 259 amino acids
Storage Conditions-20°C or -80°C
Purity>85% for partial constructs
TaggingN-terminal 10xHis-tag
FunctionDiacylglycerol transferase for lipoprotein modification

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; Sez_1357; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Target Names
lgt
Target Protein Sequence
MINPIAFKLGPLSLHWYAVCILVGLLLAVYLAAKEAPRKKMTSDDIIDFILIAFPLAIIG ARIYYVAFEWSYYSQHLSDIFAIWNGGIAIYGGLITGTIVLFVYCYYKVLNPIHFLDIAA PSVMLAQAIGRWGNFFNQEAYGKAVSQLNYLPSFIRQQMFIDGSYRVPTFLYESMWNLIG FVIIMVWRRKPRSLLDGDILSFYLIWYGCGRLVIEGMRTDSLMLLGIRVSQYVSVLLIVI AIVFIFKRHRQKGISYYQE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: sez:Sez_1357

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Streptococcus equi subsp. zooepidemicus?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme that catalyzes the first and committed step in the lipid modification pathway of bacterial lipoproteins in Streptococcus equi subspecies zooepidemicus. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins. This modification anchors exported proteins to the outer face of the plasma membrane in gram-positive bacteria like S. equi subsp. zooepidemicus. The lgt-mediated lipid modification is essential for maintaining proper lipoprotein function, which impacts various bacterial processes including nutrient acquisition, protein secretion, and virulence mechanisms .

What are the known functions of lipoproteins in S. equi subsp. zooepidemicus?

Lipoproteins in S. equi subsp. zooepidemicus serve multiple critical functions in bacterial physiology and pathogenesis:

  • Nutrient acquisition: Many lipoproteins function as substrate-binding components of ABC transporter systems essential for importing nutrients, particularly during infection where nutrients may be limited .

  • Protein secretion and folding: Specific lipoproteins like the PrtM maturase lipoprotein facilitate the proper folding and maturation of other proteins, including potential virulence factors .

  • Cell envelope integrity: Some lipoproteins contribute to maintaining the structural integrity of the bacterial cell envelope.

  • Host-pathogen interactions: Surface-exposed lipoproteins can mediate adhesion to host tissues, as evidenced by reduced colonization of equine epithelial tissues by certain lipoprotein mutants .

  • Immune evasion: Some lipoproteins may play roles in evading host immune responses, contributing to persistence during infection.

The importance of these functions is demonstrated by studies showing that mutations in specific lipoproteins (such as PrtM) can significantly attenuate virulence in both mouse models and natural host infections .

How does the lipoprotein processing pathway work in gram-positive bacteria?

The lipoprotein processing pathway in gram-positive bacteria like S. equi subsp. zooepidemicus involves a series of coordinated enzymatic steps:

  • Preprolipoprotein synthesis: Lipoproteins are initially synthesized as preprolipoproteins with an N-terminal signal peptide containing a conserved lipobox motif (typically L-A/S-G/A-C) .

  • Translocation: The Sec or Tat machinery translocates these preprolipoproteins across the cytoplasmic membrane.

  • Diacylglyceryl modification: The Lgt enzyme catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox .

  • Signal peptide cleavage: The Lsp enzyme (lipoprotein signal peptidase) cleaves the signal peptide immediately before the modified cysteine residue.

  • Membrane anchoring: The lipid-modified mature lipoprotein remains anchored to the outer face of the plasma membrane through its lipid moiety, with the protein portion extending into the extracellular space .

Unlike gram-negative bacteria, gram-positive bacteria generally lack the Lnt enzyme that would add a third acyl chain to the modified cysteine. Disruption of this pathway, particularly through mutation of lgt or lsp genes, can significantly affect bacterial physiology and virulence by preventing proper lipoprotein localization and function .

What experimental models are most effective for studying S. equi subsp. zooepidemicus lgt mutants?

Multiple experimental models offer complementary approaches for studying S. equi subsp. zooepidemicus lgt mutants, each with specific advantages:

In vitro models:

  • Air-interface organ cultures: These provide valuable insights into bacterial colonization patterns on equine epithelial tissues. Studies have shown that while specific lipoprotein mutants (e.g., ΔprtM 138-213) show reduced colonization, lgt mutants (Δlgt 190-685) colonize at levels similar to wild-type strains .

  • Mucus production assays: Wild-type S. equi and lgt mutants induce similar levels of mucus production in organ cultures, suggesting that factors responsible for this virulence phenotype remain functional despite lgt mutation .

  • Growth kinetics in nutrient-limited media: These can reveal defects in nutrient acquisition systems dependent on properly processed lipoproteins.

In vivo models:

  • Mouse model of strangles: Both lgt mutants and specific lipoprotein mutants (e.g., ΔprtM) show significant attenuation in mouse models, though lgt mutants retain some virulence (2 of 30 mice exhibited disease signs) .

  • Natural host (pony) infection: The most relevant but resource-intensive model. Studies demonstrate that specific lipoprotein mutants (ΔprtM) show complete attenuation (0 of 5 ponies exhibited disease), while lgt mutants retain substantial virulence (3 of 5 ponies showed disease signs) .

Model TypeAdvantagesLimitationsKey Findings for lgt Mutants
Air-interface organ culturesControls for variables, directly assesses colonizationLacks immune componentsSimilar colonization to wild-type
Mouse modelCost-effective, allows larger sample sizesNot natural hostSignificant attenuation but incomplete
Pony infectionNatural host, most clinically relevantExpensive, ethical considerationsLess attenuation than in mouse model

For comprehensive evaluation, a multi-model approach is recommended, starting with in vitro characterization followed by mouse models, and culminating with confirmatory studies in the natural equine host .

How do virulence profiles compare between wild-type S. equi strains and lgt mutants?

Comparative virulence profiling reveals important differences between wild-type S. equi strains and lgt mutants across different experimental systems:

In vitro epithelial colonization:

  • Lgt mutants (Δlgt 190-685) colonize air interface organ cultures at levels comparable to wild-type S. equi strain 4047 .

  • In contrast, specific lipoprotein mutants (ΔprtM 138-213) show significantly reduced colonization capacity .

Mucus production induction:

  • Both wild-type S. equi and lgt mutants induce similar levels of mucus production in organ cultures, suggesting that factors responsible for this virulence phenotype are not dependent on lgt processing .

Mouse model virulence:

Natural host (pony) infections:

  • A marked contrast to mouse studies is observed in natural host infections, where lgt mutants show less attenuation .

  • While PrtM lipoprotein mutants exhibited complete attenuation (0 of 5 infected ponies showed pathological signs of strangles), lgt mutants retained substantial virulence (3 of 5 infected ponies developed disease) .

  • Wild-type strains caused disease in all infected animals (4 of 4 ponies) .

Virulence MeasureWild-type S. equilgt Mutant (Δlgt 190-685)PrtM Mutant (ΔprtM 138-213)
Epithelial colonizationHighHighSignificantly reduced
Mucus productionHighHighReduced
Mouse virulence30/30 with disease2/30 with disease0/30 with disease
Pony virulence4/4 with disease3/5 with disease0/5 with disease

These findings suggest that while lgt processing is important for full virulence, its role may be partially compensated in the natural host. The greater attenuation of specific lipoprotein mutants compared to lgt mutants indicates that certain lipoproteins critical for virulence may retain some functionality even without proper lipid modification, or potentially undergo alternative processing pathways .

What molecular techniques are optimal for characterizing lgt function in S. equi subsp. zooepidemicus?

Several complementary molecular techniques provide comprehensive insights into lgt function in S. equi subsp. zooepidemicus:

Genetic modification techniques:

  • Precise gene deletion: Creating targeted in-frame deletions (e.g., Δlgt 190-685) enables studying loss-of-function phenotypes while minimizing polar effects on adjacent genes .

  • Allelic exchange methods: These allow for marker-free deletions or site-directed mutations to investigate specific amino acid residues important for catalytic activity.

  • Complementation studies: Reintroducing wild-type lgt confirms that observed phenotypes are specifically due to lgt deficiency rather than secondary mutations .

Protein function analysis:

  • Mass spectrometry-based proteomics: Comparing membrane proteomes of wild-type and lgt mutant strains identifies the complete set of lipoproteins dependent on lgt for processing .

  • Metabolic labeling: Using lipid analogs with bioorthogonal chemistry enables selective visualization and purification of lipidated proteins.

  • Biochemical fractionation: Techniques like Triton X-114 phase separation can enrich for lipoproteins and demonstrate processing defects in mutants.

Structural and interaction studies:

  • Heterologous expression systems: Expressing S. equi lgt in laboratory organisms allows detailed biochemical characterization.

  • In vitro enzymatic assays: Developing assays with purified recombinant lgt enables quantitative assessment of enzymatic parameters.

  • Protein-protein interaction studies: Techniques like bacterial two-hybrid systems can identify interactions between lgt and substrate proteins.

Phenotypic characterization:

  • Comparative growth analysis: Testing growth in various media can reveal nutrient acquisition defects in lgt mutants.

  • Virulence model assessment: Using both in vitro colonization models and in vivo infection models provides comprehensive virulence profiling .

Combining these techniques provides multidimensional insights into lgt function, from basic enzymatic activity to broader roles in bacterial physiology and virulence. The integration of molecular, biochemical, and phenotypic approaches is essential for a complete understanding of this important enzyme's function .

How can recombinant lgt be used in vaccine development against S. equi infections?

Recombinant lgt from S. equi subsp. zooepidemicus can contribute to vaccine development through several strategic approaches:

Direct antigen application:

  • While lgt itself may not be optimal as a vaccine antigen due to its membrane-embedded nature and enzymatic function, its recombinant expression enables various vaccine development strategies.

  • Recombinant lgt could be used to generate antibodies for passive immunization studies to evaluate protective potential.

Lipoprotein processing platform:

  • Recombinant lgt can be utilized in vitro to process potential lipoprotein vaccine candidates, preserving their native lipid modifications that may be important for immunogenicity.

  • This approach could enhance the effectiveness of subunit vaccines by presenting antigens in their naturally modified form.

Identification of vaccine candidates:

  • Using recombinant lgt to characterize the complete lipoprotein repertoire helps identify surface-exposed lipoproteins that may serve as effective vaccine antigens.

  • Specific lipoproteins like PrtM show promise as vaccine candidates based on attenuation studies in both mouse and pony models .

Attenuated vaccine strain development:

  • Knowledge gained from lgt studies can inform the creation of rationally attenuated live vaccine strains.

  • Since lgt mutants show reduced virulence while still allowing some colonization, they could potentially serve as the basis for live attenuated vaccines .

ApproachAdvantagesChallengesSupporting Evidence
Lipoprotein subunit vaccinesDefined composition, safetyMay require adjuvantsPrtM mutants show complete attenuation
Attenuated lgt mutant vaccinesNatural antigen presentationPotential residual virulencelgt mutants show attenuation in mouse models
Combination approachesBroader protectionComplexity in formulationMultiple lipoproteins likely contribute to immunity

The evidence that PrtM lipoprotein mutants are significantly attenuated in both mouse and natural host models suggests that PrtM and potentially other lipoproteins processed by lgt are promising vaccine candidates. Further investigation of their immunogenicity and protective efficacy is warranted .

What genomic approaches can identify potential substrates of lgt in S. equi subsp. zooepidemicus?

Several genomic approaches can effectively identify and characterize potential lgt substrates in S. equi subsp. zooepidemicus:

Bioinformatic prediction:

  • Lipoprotein prediction algorithms: Tools like LipoP, PRED-LIPO, and specialized bacterial lipoprotein databases can scan the S. equi genome for proteins containing signal peptides with lipobox motifs (typically L-A/S-G/A-C).

  • Genome-wide annotation: The S. equi genome project (http://www.sanger.ac.uk/Projects/S_equi/) provides valuable resources for systematic identification of potential lipoproteins .

Comparative genomic analysis:

  • Multi-species comparison: Analyzing predicted lipoproteins across related Streptococcus species identifies conserved and species-specific lgt substrates.

  • Evolutionary conservation mapping: Identifying lipoproteins conserved across pathogenic streptococci suggests functional importance in virulence.

  • Virulence island analysis: Examining whether predicted lipoproteins cluster in genomic islands associated with pathogenicity.

Transcriptomic approaches:

  • RNA-seq comparisons: Contrasting gene expression profiles between wild-type and lgt mutant strains identifies compensatory changes suggestive of functional relationships.

  • Condition-dependent expression: Identifying lipoproteins specifically expressed during infection conditions highlights potential virulence-associated substrates.

Experimental validation:

  • Proteomic analysis: Mass spectrometry comparison of membrane fractions between wild-type and lgt mutant strains directly identifies lipoproteins dependent on lgt processing.

  • Metabolic labeling: Using lipid analogs with click chemistry enables selective enrichment and identification of lipidated proteins.

Functional characterization:

  • Targeted mutagenesis: Creating deletion mutants of predicted lipoproteins and assessing virulence phenotypes, as demonstrated with the PrtM lipoprotein .

  • Complementation studies: Reintroducing predicted lipoproteins into mutant strains to confirm functional relationships.

The combined use of these approaches enables comprehensive identification and prioritization of lgt substrates for further investigation as virulence factors or vaccine candidates. The demonstrated importance of specific lipoproteins like PrtM in S. equi virulence suggests that systematic characterization of the complete lipoprotein repertoire would yield valuable insights into pathogenesis mechanisms .

What protocols are most effective for creating and validating lgt knockout mutants in S. equi subsp. zooepidemicus?

Creating and validating lgt knockout mutants in S. equi subsp. zooepidemicus requires systematic methodological approaches:

Creation Protocol:

  • Allelic exchange mutagenesis:

    • Design primers to amplify regions flanking the lgt gene (500-1000 bp each).

    • Introduce these fragments into a temperature-sensitive or suicide vector, flanking a selectable marker.

    • Create precise in-frame deletions (as in the Δlgt 190-685 construct) to minimize polar effects on downstream genes .

    • Transform S. equi with the construct and select for single-crossover integration.

    • Counter-select for double-crossover events resulting in allelic replacement.

  • CRISPR-Cas9 approaches:

    • Design guide RNAs targeting the lgt gene.

    • Provide repair templates with homology arms to direct the desired deletion.

    • This method can provide higher efficiency for difficult-to-transform organisms.

Validation Methods:

  • Genetic verification:

    • PCR analysis using primers flanking the deletion site confirms the genetic modification.

    • Sequencing of the modified region ensures precise deletion without unintended mutations.

    • Whole genome sequencing rules out secondary mutations that might contribute to phenotypes.

  • Expression analysis:

    • RT-PCR confirms absence of lgt transcript in the mutant.

    • Western blotting with anti-Lgt antibodies (if available) verifies absence of the protein.

    • RNA-seq assesses effects on expression of adjacent genes to detect any polar effects.

  • Functional validation:

    • Lipoprotein processing assessment: Mass spectrometry-based proteomics verifies disruption of lipoprotein processing in the mutant .

    • Membrane fractionation: Demonstrates altered distribution of lipoproteins between membrane and soluble fractions.

    • Phenotypic characterization: Assessment of growth in various media detects nutrient acquisition defects.

  • Complementation:

    • Reintroduction of the wild-type lgt gene under native or inducible promoter control.

    • Demonstration that complementation restores wild-type phenotypes confirms that observed effects are specifically due to lgt deletion.

  • Virulence assessment:

    • In vitro colonization models using air interface organ cultures .

    • Mouse model of strangles to assess attenuation .

    • Natural host (pony) infection studies for definitive virulence characterization .

Validation StepPurposeMethodologyExpected Outcome in lgt Mutant
Genetic confirmationVerify deletionPCR, sequencingAbsence of lgt sequence
Transcript analysisConfirm gene inactivationRT-PCR, RNA-seqNo lgt transcript
Proteomic analysisAssess lipoprotein processingMass spectrometryAltered lipoprotein profiles
ComplementationEstablish specificityGene reintroductionRestoration of wild-type phenotypes
Virulence testingDetermine functional impactAnimal modelsAttenuation in mouse models

These rigorous validation steps ensure that phenotypes attributed to lgt deletion are specific and not due to unintended genetic alterations or polar effects .

What analytical techniques best characterize lipoprotein modifications in S. equi subsp. zooepidemicus?

Several analytical techniques provide complementary insights into lipoprotein modifications in S. equi subsp. zooepidemicus:

Mass spectrometry-based approaches:

  • LC-MS/MS analysis: Enables identification of lipid-modified peptides with precise characterization of modification sites.

  • Top-down proteomics: Analyzes intact lipoproteins with their modifications, providing a comprehensive view of the protein state.

  • MALDI-TOF MS: Useful for rapid screening based on mass shifts associated with lipid modifications.

  • Quantitative proteomics: Techniques like SILAC or TMT labeling allow comparison of lipoprotein abundance between wild-type and lgt mutant strains .

Metabolic labeling techniques:

  • Radioactive labeling: Using [³H]-palmitate or [¹⁴C]-fatty acids to specifically label lipid modifications.

  • Bioorthogonal chemistry: Utilizing azide- or alkyne-modified fatty acid analogs that can be selectively detected via click chemistry reactions.

  • Pulse-chase experiments: Track the kinetics of lipoprotein processing and turnover.

Biochemical separation methods:

  • Triton X-114 phase separation: Exploits the amphipathic nature of lipoproteins for enrichment from total cellular proteins.

  • Membrane fractionation: Isolates membrane-associated lipoproteins for comparative analysis between wild-type and mutant strains .

  • Density gradient centrifugation: Separates membrane microdomains with different lipoprotein compositions.

Functional characterization:

  • Activity assays for specific lipoproteins: Assess the impact of lipid modification on function.

  • Surface accessibility studies: Determine the topology and exposure of lipoproteins on the bacterial surface.

  • In vitro processing assays: Using recombinant lgt to assess substrate specificity and processing efficiency.

Imaging techniques:

  • Immunofluorescence microscopy: Visualizes the localization of specific lipoproteins using antibodies.

  • Electron microscopy with immunogold labeling: Provides ultrastructural localization of lipoproteins.

TechniqueApplicationAdvantagesLimitations
LC-MS/MSModification site identificationPrecise site localizationRequires specialized equipment
Metabolic labelingTracking newly synthesized lipoproteinsHigh specificityMay alter bacterial physiology
Triton X-114 extractionLipoprotein enrichmentSimple, effective separationMay not capture all lipoproteins
Activity assaysFunctional impact assessmentDirect measure of functionSpecific to each lipoprotein
Membrane fractionationLocalization studiesPreserves native interactionsCross-contamination challenges

The combination of these techniques provides a comprehensive analysis of lipoprotein modifications and their functional significance in S. equi subsp. zooepidemicus. Comparative studies between wild-type strains and lgt mutants are particularly valuable for identifying lgt-dependent modifications .

How can in vitro assays quantitatively measure lgt activity in S. equi subsp. zooepidemicus?

Several in vitro assay systems can be developed to quantitatively measure lgt activity in S. equi subsp. zooepidemicus:

Radiolabeled substrate assays:

  • Principle: Incubation of recombinant lgt with [³H]- or [¹⁴C]-labeled phosphatidylglycerol and synthetic peptide substrates containing the lipobox motif.

  • Measurement: Quantification of radiolabel transfer to the peptide substrate through scintillation counting or autoradiography.

  • Advantages: High sensitivity and established methodology.

  • Limitations: Requires radioactive materials and specialized handling.

Mass spectrometry-based assays:

  • Principle: Reaction of purified lgt with synthetic peptide substrates and phospholipid donors.

  • Measurement: Direct detection of reaction products by MS to measure the mass shift associated with diacylglyceryl addition.

  • Advantages: Provides precise structural information about the modification.

  • Applications: Substrate specificity studies, inhibitor screening, and kinetic parameter determination.

Fluorescence-based assays:

  • Principle: Use of fluorescently labeled substrate peptides that exhibit changes in fluorescence properties upon lipidation.

  • Measurement: Continuous monitoring of fluorescence changes during the reaction.

  • Advantages: Real-time measurements and potential for high-throughput screening.

  • Variations: FRET-based assays using strategically positioned donor-acceptor pairs to detect conformational changes.

Colorimetric assays:

  • Principle: Coupling lgt activity to enzymatic reactions that produce colorimetric changes.

  • Measurement: Spectrophotometric detection of color development.

  • Advantages: Simple equipment requirements and potential for field applications.

  • Example: Detection of free thiol groups that are modified during the reaction using Ellman's reagent.

Heterologous expression systems:

  • Principle: Expression of S. equi lgt in a surrogate host with a reporter system linked to lipoprotein processing.

  • Measurement: Quantification of reporter signal as an indicator of lgt activity.

  • Advantages: Allows for in vivo assessment of activity and screening of large numbers of variants.

  • Applications: Mutational analysis and inhibitor screening.

Assay TypeQuantitative ParameterDetection LimitThroughputSpecial Equipment
Radiolabeled substratepmol substrate convertedLow (0.1-1 pmol)Low-mediumScintillation counter
Mass spectrometryProduct formation (ion counts)Medium (1-10 pmol)MediumMass spectrometer
Fluorescence-basedRelative fluorescence unitsMedium (5-50 pmol)HighFluorescence plate reader
ColorimetricAbsorbance unitsHigh (50-100 pmol)HighSpectrophotometer

For rigorous enzymatic characterization, assay optimization should include determination of enzyme kinetics parameters (Km, Vmax), specificity for different phospholipid donors and peptide substrates, pH and temperature optima, and susceptibility to inhibitors. These quantitative assays provide essential tools for dissecting the biochemical properties of lgt and its role in lipoprotein processing in S. equi subsp. zooepidemicus .

What structural biology approaches contribute to understanding lgt function in S. equi subsp. zooepidemicus?

Structural biology offers powerful approaches to understand lgt function in S. equi subsp. zooepidemicus at the molecular level:

X-ray crystallography:

  • Application: Determination of the three-dimensional structure of purified lgt at atomic resolution.

  • Insights: Identification of catalytic residues, substrate-binding sites, and structural motifs.

  • Advanced applications: Co-crystallization with substrates, substrate analogs, or inhibitors to characterize the active site.

  • Challenges: Obtaining diffraction-quality crystals of membrane proteins like lgt is technically demanding.

Cryo-electron microscopy (cryo-EM):

  • Application: Structural analysis of lgt in its native membrane environment or in nanodiscs.

  • Advantages: Can visualize larger complexes and doesn't require crystallization.

  • Insights: Visualization of lgt within the membrane context and potentially in complex with other lipoprotein processing components.

  • Recent advances: Improved resolution capabilities make this increasingly valuable for membrane protein structure determination.

NMR spectroscopy:

  • Application: Characterization of dynamic regions and conformational changes in lgt.

  • Insights: Study of protein-substrate interactions in solution and identification of flexible regions.

  • Specialized applications: Solid-state NMR for membrane-embedded portions of the protein.

  • Limitations: Size constraints may necessitate studying individual domains rather than the full protein.

Molecular dynamics simulations:

  • Application: In silico modeling of lgt interaction with the membrane and substrates.

  • Insights: Simulation of conformational changes during catalysis and prediction of substrate binding modes.

  • Integration: Computational approaches can complement experimental structural data and extend insights.

  • Advances: Modern computing power enables longer simulations with more realistic membrane environments.

Structure-guided functional studies:

  • Application: Site-directed mutagenesis of residues predicted to be important for catalysis or substrate binding.

  • Validation: Functional characterization of mutants to confirm structural predictions.

  • Integration: Combining structural information with evolutionary conservation analysis to identify functionally critical residues.

Structural ApproachResolution RangeAdvantagesChallenges for lgt Study
X-ray crystallography1-3 ÅAtomic-level detailCrystallization of membrane protein
Cryo-EM2.5-4 ÅNative environmentSample preparation, size requirements
NMR spectroscopyAtomic resolution for dynamicsDynamic informationSize limitations
Molecular dynamicsDependent on starting structureMechanistic insightsComputational demands

Structural information about lgt would be particularly valuable given the enzyme's importance in bacterial physiology and virulence. Understanding the molecular details of substrate recognition and catalysis could inform the development of new antimicrobial strategies targeting the lipoprotein processing pathway in S. equi subsp. zooepidemicus and related pathogens .

How does S. equi subsp. zooepidemicus transmission to humans impact research safety protocols?

The zoonotic potential of S. equi subsp. zooepidemicus necessitates stringent research safety protocols:

Transmission risks:

  • S. equi subsp. zooepidemicus is recognized as an emerging zoonosis transmitted from horses to humans .

  • Human infections with S. equi subsp. zooepidemicus are often severe, including septicemia, meningitis, and purulent arthritis .

  • Multiple cases of severe, disseminated S. equi subsp. zooepidemicus infection have been documented in persons working with horses .

  • Molecular typing methods have confirmed that human and equine isolates can be identical or closely related, confirming direct transmission .

Laboratory safety measures:

  • Biosafety Level 2 (BSL-2) practices are minimum requirements for handling S. equi subsp. zooepidemicus.

  • Personal protective equipment should include gloves, lab coats, eye protection, and potentially respiratory protection when working with aerosol-generating procedures.

  • Biological safety cabinets should be used for procedures with potential for generating infectious aerosols.

  • Strict handwashing protocols and prohibition of eating, drinking, or applying cosmetics in laboratory areas.

Handling clinical and research samples:

  • All clinical samples from horses should be considered potentially infectious.

  • Standard microbiological practices including sealed centrifuge rotors and secondary containment during transport.

  • Proper decontamination of all surfaces and equipment after use with appropriate disinfectants.

  • Proper disposal of all contaminated materials according to institutional biohazard policies.

Special considerations for recombinant work:

  • Additional containment measures may be required when working with recombinant strains expressing virulence factors.

  • Risk assessment should consider potential for increased virulence or altered host range in recombinant constructs.

  • Documentation and approval from institutional biosafety committees before initiating recombinant work.

Risk FactorMitigation StrategyMonitoring Method
Direct contact with culturesGloves, lab coats, appropriate PPECompliance audits
Aerosol generationBiological safety cabinets, respiratory protectionAir sampling when warranted
Contaminated sharpsSharps containers, minimized use of sharpsIncident reporting
Accidental exposureEstablished exposure protocolsMedical follow-up

The evidence that S. equi subsp. zooepidemicus can cause severe human infections emphasizes the importance of these safety measures. Early identification of potential infections through awareness of symptoms and rapid diagnostic testing is essential for researchers working with this organism . Laboratory accidents should be documented with appropriate medical follow-up, and all personnel should receive specific training on the zoonotic potential of this pathogen .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.