Recombinant Streptococcus gordonii Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

The properties of recombinant S. gordonii plsY protein have been extensively characterized, with key parameters outlined in the table below:

ParameterSpecification
OrganismStreptococcus gordonii
Expression SystemE. coli
TagHis (N-terminal)
LengthFull length (1-214 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
UniProt IDQ9X972
Gene SynonymsplsY; SGO_1246

The recombinant protein exhibits excellent stability when stored properly, though repeated freeze-thaw cycles can compromise its enzymatic activity . For optimal preservation, aliquoting is recommended with storage at -20°C or -80°C in a suitable buffer containing trehalose as a stabilizing agent .

Metabolic Pathway Integration

The metabolic significance of plsY lies in its position as a gatekeeper enzyme for phospholipid biosynthesis. By catalyzing the initial acylation reaction in this pathway, plsY effectively controls the flux of metabolites toward membrane lipid production. This function is particularly critical for bacteria, where phospholipid composition directly impacts membrane fluidity, permeability, and ultimately cell viability.

Recombinant Production and Purification Methods

The production of recombinant S. gordonii plsY involves several critical steps to ensure high yield and purity. The gene encoding plsY (SGO_1246) is typically cloned into an expression vector with a histidine tag sequence and transformed into E. coli for protein expression . After induction and cell lysis, the His-tagged protein can be purified using nickel affinity chromatography.

Research Applications and Significance

The availability of recombinant S. gordonii plsY enables various research applications, from fundamental studies on bacterial lipid metabolism to potential therapeutic development. Understanding the role of plsY in S. gordonii is particularly relevant given this organism's significance in human health and disease.

Relevance to Oral Microbiology and Pathogenesis

Streptococcus gordonii is recognized as a primary colonizer in the human oral cavity and plays a significant role in the formation of dental plaque biofilms . Moreover, S. gordonii can act as an opportunistic pathogen, with the potential to cause infective endocarditis by colonizing damaged heart valve surfaces . Various surface proteins of S. gordonii, including AbpA and AbpB, have been implicated in interactions with host molecules such as salivary amylase, which may contribute to its colonization capabilities .

While the specific contribution of plsY to S. gordonii virulence has not been extensively characterized in the available literature, the critical role of lipid metabolism in bacterial adaptation and survival suggests that this enzyme could influence the organism's pathogenic potential. Phospholipid composition affects membrane properties, which in turn can impact adhesion, biofilm formation, and resistance to host defense mechanisms.

Comparative Analysis with Other Bacterial Acyltransferases

Understanding S. gordonii plsY in relation to similar enzymes in other bacterial species provides valuable insights into evolutionary conservation and specialization of lipid metabolism pathways. While mammalian GPATs have been classified into distinct groups based on localization (mitochondrial versus endoplasmic reticulum), bacterial GPATs like plsY exhibit unique structural and functional characteristics adapted to prokaryotic cellular organization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SGO_1246; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Target Names
plsY
Target Protein Sequence
MINTILGLILAYLLGSIPTGLWIGQIFFKKNLREYGSGNTGTTNTFRILGKTAGTVTFAI DFLKGTLATLLPLFLHINGISPMIFGLIAVLGHTFPIFAEFKGGKAVATSAGVVLGFSPL FFSYLIIIFIVTLYLGSMISLASIVVAGFAIISVLIFPLLGIILPSYDLLFTLIIILLAS IILIRHRDNMERIKNKSENLIPWGINITKQVPKK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Glycerol-3-phosphate acyltransferase (plsY) in Streptococcus gordonii?

Glycerol-3-phosphate acyltransferase (plsY) in S. gordonii catalyzes the first committed step in phospholipid biosynthesis, transferring an acyl group to glycerol-3-phosphate to form lysophosphatidic acid. This reaction is critical for membrane biogenesis. In S. gordonii, the enzyme plays an essential role in maintaining cell wall integrity, which directly impacts the bacterium's ability to express various cell wall proteins, including Streptococcal surface proteins (SspA, SspB) and serine-rich repeat (SRR) glycoproteins that mediate adhesion to host surfaces . The membrane composition resulting from plsY activity significantly influences how S. gordonii interacts with host tissues and other microorganisms in biofilm communities .

How does plsY activity contribute to S. gordonii pathogenesis and commensalism?

The plsY enzyme contributes to S. gordonii's dual nature as both a commensal organism and potential pathogen through its effects on membrane composition and surface protein presentation. By maintaining appropriate membrane phospholipid content, plsY ensures proper anchoring and display of cell wall-anchored glycoproteins, particularly SRR adhesins like GspB and Hsa, which mediate binding to sialylated carbohydrates on platelets and erythrocytes . This binding ability can lead to S. gordonii translocation to the endocardium, potentially contributing to infective endocarditis pathogenesis . Simultaneously, in its commensal role, plsY-mediated membrane composition supports the expression of surface proteins that allow S. gordonii to establish stable niches in the oral cavity without triggering excessive inflammatory responses .

What expression systems are most effective for producing recombinant S. gordonii plsY?

For effective expression of recombinant S. gordonii plsY, several systems have been evaluated with varying degrees of success. Heterologous expression in E. coli using specialized strains designed for membrane protein production (such as C41/C43) has shown promising results. When expressing S. gordonii proteins in E. coli, standard procedures for gene fusion construction and mutagenesis can be employed, though careful optimization is required for membrane proteins . Alternatively, expression in other Gram-positive hosts may provide a more native-like membrane environment. The use of inducible expression systems with careful control of induction parameters (temperature, inducer concentration, and timing) is critical for obtaining functional enzyme. Expression vectors containing appropriate fusion tags (His-tag, MBP) can improve both expression and subsequent purification while maintaining enzyme activity.

What are the optimal purification strategies for maintaining recombinant S. gordonii plsY activity?

Maintaining recombinant S. gordonii plsY activity during purification requires specialized approaches that preserve the native structure of this membrane-associated enzyme. Successful purification typically involves:

Purification StageOptimal ConditionsCritical Considerations
Cell LysisMechanical disruption or mild detergentsAvoid harsh conditions that may denature membrane proteins
SolubilizationMild detergents (DDM, LMNG) at 1-2× CMCDetergent selection significantly impacts activity retention
Affinity ChromatographyIMAC with His-tag or other affinity tagsInclude detergent in all buffers; elute with imidazole gradient
Size ExclusionBuffer containing 0.05-0.1% detergentAssess protein quality and remove aggregates
Storage10-20% glycerol, pH 7.0-7.5, at -80°CFlash freeze in small aliquots to prevent activity loss

Throughout purification, maintaining a stable lipid environment by including phospholipids or using lipid-like detergents provides critical stabilizing effects for this membrane enzyme .

How can enzyme activity assays be optimized for recombinant S. gordonii plsY?

Optimizing enzyme activity assays for recombinant S. gordonii plsY requires addressing the challenges associated with membrane protein enzymology. While specific protocols for S. gordonii plsY are not detailed in the provided search results, effective approaches typically include:

  • Spectrophotometric coupled assays that link acyltransferase activity to NAD+ reduction, allowing continuous monitoring at 340 nm

  • Radiometric assays using 14C-labeled glycerol-3-phosphate or acyl donors for high sensitivity

  • Fluorescence-based assays using modified substrates that produce detectable signals upon reaction

Reaction conditions should be carefully optimized for pH (7.0-7.5), temperature (30-37°C), and ionic strength. When determining kinetic parameters, it's crucial to vary one substrate concentration while maintaining others at saturating levels. For assays using purified enzyme, the detergent type and concentration must be standardized, as these significantly impact substrate presentation and enzyme activity .

How does recombinant expression of plsY affect S. gordonii cell surface properties?

Recombinant expression of plsY can significantly alter S. gordonii cell surface properties through its impact on membrane phospholipid composition. Modified plsY expression affects:

  • Surface hydrophobicity and charge: Changes in phospholipid composition alter the physical properties of the cell surface, influencing initial attachment to surfaces

  • Adhesin display: The membrane environment affects the proper folding, transport, and anchoring of cell wall proteins such as SRR adhesins (GspB and Hsa)

  • Biofilm formation: S. gordonii strains with altered plsY expression show differences in biofilm development on various substrates

The search results indicate that many S. gordonii LPXTG/A proteins, which require proper membrane anchoring dependent on phospholipid composition, impact biofilm formation on multiple substrates. Additionally, alterations in these surface proteins affect properties like hemagglutination and hydrophobicity, which are critical for bacterial interactions with host surfaces .

How can recombinant S. gordonii expressing modified plsY be utilized in vaccine development?

Recombinant S. gordonii with modified plsY expression offers promising applications in vaccine development strategies. S. gordonii has been successfully used as a commensal bacterial vector for vaccine delivery, as demonstrated by studies incorporating heterologous antigens like the M6 protein from Streptococcus pyogenes . For optimizing such vaccine vectors:

  • Modified plsY expression can be leveraged to enhance surface display of heterologous antigens by creating an optimal membrane environment

  • Strategic modifications in membrane composition through plsY modulation may improve the stability and immunogenicity of displayed antigens

  • Recombinant S. gordonii vectors can be engineered with specific mutations to optimize vaccine responses

Research has shown that modifications to recombinant S. gordonii, such as adding alpha-helical spacers between target epitopes and anchor motifs, can significantly increase antibody responses to displayed antigens. Similar engineering approaches involving plsY modification could potentially enhance vaccine efficacy by optimizing membrane properties for antigen presentation .

What role does plsY play in S. gordonii interactions with host immune cells?

The plsY enzyme influences S. gordonii interactions with host immune cells through its effects on membrane composition and the subsequent presentation of surface immunomodulatory molecules. Research has shown that:

  • S. gordonii surface adhesins, whose display is dependent on proper membrane composition, interact with sialoglycoproteins on monocyte membranes (CD11b, CD43, CD50)

  • These interactions can trigger immune cell responses, including differentiation of monocytes into dendritic cells and production of cytokines such as TNF-α, IL-6, and IL-12

  • Lipoproteins of S. gordonii, whose proper anchoring in the membrane requires appropriate phospholipid composition, induce expression of the dendritic cell surface marker CD80 and influence regulatory T cell populations

Modifications in plsY activity that alter membrane phospholipid profiles can therefore significantly impact these immunomodulatory capabilities. This understanding is valuable for developing S. gordonii-based therapeutics with controlled immune-stimulatory properties .

How can CRISPR-Cas9 techniques be optimized for genetic manipulation of plsY in S. gordonii?

Optimizing CRISPR-Cas9 for genetic manipulation of plsY in S. gordonii requires careful consideration of several factors specific to this Gram-positive organism. While the search results don't specifically address CRISPR methods for S. gordonii plsY modification, general approaches for genetic manipulation of S. gordonii can be adapted:

  • Guide RNA design should target unique sequences within the plsY gene while minimizing off-target effects

  • Delivery methods need optimization for S. gordonii, with electroporation of ribonucleoprotein complexes often proving more efficient than plasmid-based systems

  • As plsY is likely essential, conditional knockout strategies using inducible promoters would be preferable to direct gene deletion

  • Homology-directed repair templates can be designed to introduce specific mutations or reporter tags for functional studies

Since S. gordonii is naturally competent, transformation protocols using chromosomal DNA or plasmids can achieve genetic modifications, as demonstrated in studies of other surface proteins . Following genome editing, thorough validation through sequencing and functional assays is essential to confirm the desired modifications.

What approaches can be used to study plsY-mediated changes in S. gordonii membrane composition?

Studying plsY-mediated changes in S. gordonii membrane composition requires a multi-faceted approach combining genetic, biochemical, and biophysical techniques:

  • Lipidomic analysis using liquid chromatography-mass spectrometry (LC-MS/MS) to identify and quantify changes in specific phospholipid species

  • Membrane fluidity assessment using fluorescence anisotropy with probes like DPH or Laurdan

  • Fatty acid profiling by gas chromatography to detect alterations in acyl chain distributions

  • Electron microscopy to examine physical changes in membrane structure and organization

For experimental approaches, constructing S. gordonii strains with controlled plsY expression levels allows comparison of membrane properties under varying enzyme activity. Since complete loss of plsY function may be lethal, conditional expression systems or partial loss-of-function mutations provide viable experimental models. These approaches can reveal how plsY activity influences the complex interplay between phospholipid biosynthesis and membrane properties in S. gordonii .

How does plsY function contribute to S. gordonii competitiveness in multispecies biofilms?

The plsY enzyme contributes significantly to S. gordonii's competitiveness in multispecies biofilms through its influence on membrane composition and subsequent effects on surface interactions. Research on S. gordonii in biofilm communities has revealed:

Modified plsY activity can alter these surface properties, affecting S. gordonii's ability to establish itself within complex oral biofilms. Functional analysis of surface proteins revealed both redundant and unique roles in biofilm formation, suggesting complex adaptive strategies dependent on proper membrane composition. The search results indicate that S. gordonii mutants with alterations in cell surface proteins demonstrate significant differences in fitness within ex vivo plaque biofilm communities, highlighting the importance of these plsY-dependent surface characteristics .

What are common obstacles in working with recombinant S. gordonii plsY and how can they be overcome?

Working with recombinant S. gordonii plsY presents several challenges due to its nature as a membrane-associated enzyme. Common obstacles and their solutions include:

ChallengeSolution Approach
Low expression yieldsUse specialized expression strains; optimize codon usage; employ low induction temperatures (16-20°C)
Protein misfoldingInclude chaperone co-expression; use fusion partners that enhance folding; optimize membrane-mimetic environments
Aggregation during purificationScreen multiple detergents; include stabilizing lipids; use gentle purification methods
Activity loss during storageAdd glycerol (10-20%); include reducing agents; store in small aliquots; consider liposome reconstitution
Difficulties in activity measurementDevelop coupled enzyme assays; optimize substrate presentation in detergent micelles

Drawing from standard procedures used for gene fusions and mutagenesis in E. coli vectors , researchers can modify approaches specifically for this challenging membrane protein. Establishing robust expression and purification protocols is essential before attempting functional or structural studies.

How can researchers distinguish between direct plsY effects and secondary impacts on S. gordonii physiology?

Distinguishing direct plsY effects from secondary impacts on S. gordonii physiology requires carefully designed experimental approaches:

  • Use of conditional expression systems allows temporal control of plsY levels, helping to separate immediate enzymatic effects from downstream adaptive responses

  • Point mutations in catalytic residues versus regulatory domains can differentiate between effects due to catalytic activity versus protein-protein interactions

  • Complementation studies with wild-type or mutant plsY variants can confirm whether phenotypes are directly attributable to plsY function

  • Time-course experiments following plsY modification can track the progression of changes, with early effects more likely representing direct consequences of altered enzyme activity

  • Correlation analysis between phospholipid profiles and phenotypic changes can establish causative relationships

When studying surface protein expression in S. gordonii, similar approaches have been used to determine the specific effects of protein modifications, such as N-terminal trimming or addition of spacers, on protein function and immune responses . These methodologies can be adapted to study plsY-specific effects.

What quality control measures are essential when working with recombinant S. gordonii plsY?

Ensuring quality control when working with recombinant S. gordonii plsY involves multiple validation steps throughout the experimental workflow:

  • Expression verification: Western blot analysis with antibodies against affinity tags or the plsY protein itself

  • Purity assessment: SDS-PAGE with Coomassie staining and quantitative densitometry to determine purity percentage

  • Functional validation: Enzyme activity assays to confirm that the purified protein catalyzes the expected reaction

  • Structural integrity: Circular dichroism or fluorescence spectroscopy to verify proper protein folding

  • Homogeneity analysis: Size exclusion chromatography to detect aggregation or oligomeric states

  • Mass spectrometry: Confirmation of protein identity and post-translational modifications

  • Thermal stability assessment: Differential scanning fluorimetry to evaluate protein stability

These quality control measures are particularly important for membrane proteins like plsY, which are prone to misfolding and aggregation. In studies of recombinant S. gordonii surface proteins, similar validation steps have been crucial for ensuring that the expressed proteins maintain their expected functional properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.