Recombinant Streptococcus gordonii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt and Its Role in Bacterial Lipoprotein Biogenesis

Prolipoprotein diacylglyceryl transferase (Lgt) is a conserved enzyme in Gram-positive bacteria responsible for lipidating prelipoproteins. It transfers a diacylglycerol moiety to the cysteine residue within the conserved "lipobox" motif (LXXC) of prelipoproteins, enabling their membrane anchoring and subsequent cleavage by lipoprotein-specific signal peptidase II (Lsp) . In Streptococcus gordonii, Lgt is critical for the maturation of surface-exposed lipoproteins, which are pivotal for bacterial virulence and immune evasion.

Lipoprotein Maturation and Virulence

  • Lgt-Deficient Mutants: S. gordonii Δlgt mutants lack lipid-modified lipoproteins, leading to impaired membrane anchoring and secretion of unmodified prelipoproteins (e.g., OppA, PrsA) .

  • Immune Evasion: Lipoproteins are potent TLR2 agonists. Δlgt mutants show reduced TNF-α induction in macrophages and endothelial cells but retain some residual activity due to trace lipoproteins in culture supernatants .

  • Adhesion and Biofilm Formation: S. gordonii Lgt is essential for adhesion to human umbilical vein endothelial cells (HUVECs), a critical step in infective endocarditis .

B. Comparative Analysis of Wild-Type vs. Δlgt Mutants

ParameterWild-TypeΔlgt Mutant
TLR2 ActivationHigh (via diacylated lipoproteins)Low (reliant on residual lipoproteins)
Adhesion to HUVECsEfficientImpaired
Clearance in MicePersistent infectionRapid clearance (spleen/liver)

Recombinant Lgt as a Research Tool

The recombinant Lgt protein is commercially available for ELISA and biochemical assays to study lipidation processes or antibody responses .

Vaccine Development

  • Targeting Lipoproteins: Since S. gordonii lipoproteins are more immunogenic than lipoteichoic acid (LTA) , Lgt-deficient mutants may serve as attenuated vaccine candidates.

  • Adjuvant Potential: Purified Lgt or lipoproteins could enhance TLR2-mediated immune responses in vaccine formulations .

Lgt Dependency in Lipoprotein Processing

  • LspA Interaction: In Streptococcus mutans, Lgt lipidation is not strictly required for LspA cleavage, but lipidation enhances membrane retention .

  • Host Cell Activation: S. gordonii Lgt-deficient strains show reduced cytokine induction (e.g., TNF-α, IL-6) in monocytic and epithelial cells compared to wild-type .

Role in Mucosal Delivery Systems

While not directly involving Lgt, recombinant S. gordonii has been engineered to deliver therapeutic proteins (e.g., H6 scFv) for vaginal candidiasis, demonstrating its potential as a mucosal delivery vector .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us to prioritize its incorporation.
Synonyms
lgt; SGO_0737; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Target Names
lgt
Target Protein Sequence
MINPIAFQIGPFAIRWYAICILSGLILAVYLARKEAPRKKIKPDDIIDFILIAFPLAIVG ARLYYVAFEWSYYSKQPFIEIFITWHGGLAIYGGLITGALVLYFFSRSKFINTLDFLDIA APGVMIAQSIGRWGNFINQEAYGAAVKSLNYLPDFIRQQMYIDGAYRQPTFLYESTWNLL GFILILFLRRKPKFLKQGDITAFYLIWYGCGRMIIEGMRTDSLYFMGLRVSQWLSALLII LGVVLVIYQHRKKDTPYYYTSLETEKKNA
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Streptococcus gordonii and what is its function?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme encoded by the lgt gene in Streptococcus gordonii. This enzyme catalyzes a critical step in lipoprotein maturation by transferring a diacylglycerol lipid unit to a cysteine residue located in the conserved N-terminal "lipobox" of prolipoproteins . This post-translational modification is crucial for proper lipoprotein anchoring to the bacterial cell membrane. In Gram-positive bacteria like S. gordonii, the lgt-modified lipoproteins remain on the extracellular surface of the cytoplasmic membrane, where they perform diverse physiological functions including nutrient acquisition, adherence, adaptation to environmental changes, protein maturation, and bacterial growth regulation . Importantly, lipoproteins also play significant roles in bacterial pathogenesis and host-pathogen interactions.

How do researchers create lgt-deficient mutants of S. gordonii and what are their characteristics?

Researchers typically employ double-crossover recombination techniques to generate lgt-deficient mutants of S. gordonii. This methodology involves:

  • Designing PCR primers to amplify regions flanking the lgt gene

  • Inserting an antibiotic resistance cassette between these flanking regions

  • Transforming the construct into S. gordonii

  • Selecting transformants on antibiotic-containing media

  • Confirming gene deletion through PCR and sequencing

  • Reduced ability to adhere to human umbilical vein endothelial cells

  • More rapid clearance from blood and organs such as the spleen and liver in mouse models

  • Significantly diminished capacity to induce pro-inflammatory cytokines (TNF-α, IL-8, IL-1β) in human monocytic cell lines and mouse bone marrow-derived macrophages

  • Reduced capacity to downregulate CD4+, CD25+, and Foxp3+ regulatory T cells in murine infection models

These characteristics make lgt-deficient mutants valuable tools for investigating the role of lipoproteins in S. gordonii pathogenesis.

How does S. gordonii lgt contribute to bacterial pathogenesis?

S. gordonii, though normally a commensal organism found in the oral cavity, can act as an opportunistic pathogen causing serious conditions including infective endocarditis and apical periodontitis . The lgt enzyme plays a crucial role in pathogenesis through several mechanisms:

  • Immune activation: S. gordonii lipoproteins processed by lgt are potent activators of Toll-like receptor 2 (TLR2), triggering the MyD88-dependent signaling pathway . This activation leads to the production of pro-inflammatory cytokines and chemokines.

  • Adherence to host tissues: lgt-processed lipoproteins facilitate bacterial adherence to host tissues, including tooth surfaces and heart valves, contributing to biofilm formation . Wild-type S. gordonii shows stronger adherence to human umbilical vein endothelial cells compared to lgt-deficient mutants .

  • Modulation of host immune responses: Through TLR2 activation, S. gordonii lipoproteins induce the production of TNF-α, IL-6, IL-12p70, and IL-10, and upregulate the expression of DC surface marker CD80 on bone-marrow dendritic cells . Additionally, wild-type strains, but not lipoprotein-deficient mutants, reduce the frequency of regulatory T cells in infection models .

  • Tissue-specific inflammatory responses: In human periodontal ligament cells, purified lipoproteins from S. gordonii induce IL-8 production through the TLR2-mediated mitogen-activated protein kinase pathway . Similarly, human dental pulp cells express pro-inflammatory mediators like IL-8 and MCP-1 when exposed to S. gordonii lipoproteins .

These mechanisms highlight the significant contribution of lgt to the virulence potential of S. gordonii in various infection settings.

What are the optimal protocols for expressing and purifying recombinant S. gordonii lgt?

While the search results don't provide a specific protocol for S. gordonii lgt, researchers can adapt established methods for similar bacterial transferases. A recommended expression and purification protocol would include:

  • Gene cloning:

    • Amplify the S. gordonii lgt gene using high-fidelity PCR

    • Clone into an expression vector (pET series vectors are commonly used) with an N-terminal His-tag for purification

    • The construct should include the catalytic domain (similar to the Arg63-Pro354 region used for human transferases)

  • Expression system:

    • Transform into E. coli BL21(DE3) or similar expression strains

    • Culture in LB medium supplemented with appropriate antibiotics

    • Induce protein expression with IPTG (0.5-1 mM) when culture reaches OD600 of 0.6-0.8

    • Express at lower temperatures (16-20°C) for 16-18 hours to enhance solubility

  • Protein purification:

    • Harvest cells and lyse using sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

    • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

    • Purify using Ni-NTA affinity chromatography

    • Elute with imidazole gradient (50-300 mM)

    • Further purify using size exclusion chromatography

    • Verify purity using SDS-PAGE and Western blotting

  • Activity verification:

    • Assess enzymatic activity using a phosphatase-coupled glycosyltransferase assay similar to that used for other transferases

    • Confirm proper folding using circular dichroism spectroscopy

This methodological approach can be optimized based on specific research requirements and the physicochemical properties of S. gordonii lgt.

How can researchers effectively measure the enzymatic activity of recombinant S. gordonii lgt?

Measuring the enzymatic activity of recombinant S. gordonii lgt requires specific assays that detect the transfer of diacylglycerol to substrate prolipoproteins. Researchers can employ several complementary approaches:

  • Radio-labeled substrate assay:

    • Prepare synthetic peptides containing the lipobox motif (consensus sequence L-A/S-G/A-C)

    • Label the peptides with radioactive isotopes (³H or ¹⁴C)

    • Incubate with purified lgt and diacylglycerol donor

    • Measure incorporation of radioactivity into the peptide substrate

    • Calculate enzyme activity based on radioactivity transfer rates

  • Phosphatase-coupled glycosyltransferase assay:

    • This method, adapted from approaches used for other transferases , couples the diacylglycerol transfer reaction to the release of inorganic phosphate

    • The released phosphate is detected using colorimetric or fluorometric methods

    • Monitor reaction kinetics in real-time

  • Mass spectrometry-based assay:

    • Incubate synthetic prolipoprotein substrates with recombinant lgt

    • Analyze reaction products using MALDI-TOF or LC-MS/MS

    • Detect mass shifts corresponding to the addition of diacylglycerol moieties

    • This approach provides both qualitative and quantitative data on enzyme activity

  • Comparative analysis with lgt mutants:

    • Compare lipoprotein profiles between wild-type and lgt-deficient S. gordonii using 2D gel electrophoresis

    • Identify specific lipoproteins affected by lgt mutation

    • Use these identified lipoproteins as natural substrates in in vitro assays

These methodologies can be used individually or in combination to comprehensively characterize the enzymatic properties of recombinant S. gordonii lgt.

What experimental approaches best elucidate the impact of lgt mutation on S. gordonii virulence?

To effectively investigate how lgt mutation affects S. gordonii virulence, researchers should implement a multi-faceted experimental approach:

  • In vivo infection models:

    • Endocarditis model: Inoculate wild-type and lgt-deficient S. gordonii into animals with mechanically damaged heart valves to assess differences in colonization and vegetation formation

    • Competitive index assays: Co-infect animals with wild-type and lgt-mutant strains at equal ratios and measure their relative recovery from infected tissues over time

    • Systemic clearance studies: Track bacterial clearance rates from blood and organs (spleen, liver) following intravenous injection

  • Biofilm formation assessments:

    • In vitro biofilm assays on relevant surfaces (hydroxyapatite, collagen, fibrinogen)

    • Confocal microscopy analysis of biofilm architecture

    • Flow chamber studies to assess biofilm formation under shear stress conditions

  • Host-pathogen interaction studies:

    • Cell adhesion assays: Compare adhesion of wild-type and lgt-mutant strains to human umbilical vein endothelial cells, oral epithelial cells, and platelets

    • Immune cell stimulation: Measure cytokine production by human monocytic cell lines, dendritic cells, and macrophages exposed to wild-type versus lgt-deficient bacteria

    • Regulatory T cell modulation: Assess impact on frequency of CD4+, CD25+, and Foxp3+ regulatory T cells in infection models

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to compare gene expression profiles between wild-type and lgt-mutant strains

    • Quantitative proteomics to identify compensatory changes in protein expression

    • Secretome analysis to examine differences in protein secretion patterns

  • Functional complementation studies:

    • Restore the lgt gene in mutant strains and assess recovery of virulence phenotypes

    • Express heterologous lgt genes from related species to determine functional conservation

These complementary approaches provide a comprehensive understanding of lgt's role in S. gordonii virulence and host interaction.

How does S. gordonii lgt compare to analogous enzymes in other streptococcal species?

The lgt enzyme in S. gordonii shares functional similarities with those in other streptococcal species, but important differences exist that impact bacterial physiology and virulence:

SpeciesEffect of lgt Mutation on GrowthImpact on VirulenceEffect on Nutrient AcquisitionImmune Activation Potential
S. gordoniiNo apparent effect on morphology, size, or growth patterns Reduced adherence to endothelial cells; more rapid clearance from blood and organs Not specifically reportedStrong reduction in pro-inflammatory cytokine induction
S. sanguinisImpaired growth Reduced virulence in endocarditis models Not specifically reportedNot specifically reported
S. pneumoniaeReduced growth in cation-depleted medium Attenuated virulence Reduced intracellular concentrations of Fe²⁺, Zn²⁺, and Mn²⁺ Not specifically reported
S. mutansDifferences in growth and physiological properties Not specifically reportedNot specifically reportedNot specifically reported

These comparative differences highlight species-specific adaptations in how streptococci utilize lipoproteins for survival and virulence. The fact that S. gordonii shows no growth defects despite lgt mutation suggests alternative mechanisms for maintaining membrane integrity and function compared to other streptococci. This information is valuable for researchers designing therapeutic strategies targeting specific streptococcal species while minimizing off-target effects on commensal flora.

What are the most effective strategies for investigating lgt-lipoprotein interactions in S. gordonii?

Understanding the interactions between lgt and its lipoprotein substrates in S. gordonii requires sophisticated molecular and structural biology approaches:

  • Substrate specificity analysis:

    • Bioinformatic identification of putative lipoproteins in the S. gordonii genome using lipobox motif prediction

    • Synthetic peptide library screening to determine optimal substrate sequences

    • Site-directed mutagenesis of the lipobox motif in selected lipoproteins to validate prediction algorithms

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM analysis of recombinant lgt, alone and in complex with substrate peptides

    • Molecular dynamics simulations to model enzyme-substrate interactions

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged recombinant lgt and bacterial lysates

    • Surface plasmon resonance to measure binding kinetics between lgt and putative substrates

    • Bacterial two-hybrid systems to screen for lgt-interacting proteins

  • In vivo validation:

    • Selective labeling of lipoproteins using bioorthogonal chemistry approaches

    • Quantitative proteomics comparing lipoprotein abundance in wild-type versus lgt-deficient strains

    • CRISPR interference to modulate lgt expression and observe effects on specific lipoproteins

  • Comparative genomics and evolution:

    • Analysis of lgt and lipoprotein conservation across streptococcal species

    • Correlation of lipoprotein repertoire with ecological niches and pathogenic potential

    • Evolutionary trajectory analysis to identify co-evolving protein pairs

These methodologies collectively provide a comprehensive understanding of how lgt recognizes and processes specific lipoproteins in S. gordonii, informing potential therapeutic interventions.

How does lgt activity influence S. gordonii interactions with other oral microbiota?

The activity of lgt significantly impacts S. gordonii's interactions with other oral microbes, influencing polymicrobial community dynamics in several ways:

  • Co-aggregation with other bacteria:

    • Lipoproteins processed by lgt likely contribute to S. gordonii's role as an early colonizer that facilitates attachment of late colonizers

    • Experimental approach: Compare co-aggregation of wild-type versus lgt-deficient S. gordonii with partners like Porphyromonas gingivalis and Fusobacterium nucleatum using quantitative co-aggregation assays

  • Influence on biofilm community composition:

    • S. gordonii lipoproteins may modulate the attachment and growth of other species within mixed biofilms

    • Experimental approach: Develop multi-species biofilm models with wild-type or lgt-deficient S. gordonii as the foundational species and analyze community composition using 16S rRNA sequencing

  • Metabolic interactions:

    • Since lipoproteins are involved in nutrient acquisition, lgt mutation likely affects cross-feeding relationships with other bacteria

    • Experimental approach: Perform metabolomic analysis of spent media from mono- and co-cultures to identify differential metabolite utilization patterns

  • Modulation of streptococcal gtf activity:

    • S. gordonii amylase-binding proteins (which may be affected by lgt processing) have been shown to interact with and modulate the activity of S. mutans glucosyltransferases (Gtfs)

    • The search results indicate that "Salivary amylase and/or His-AbpB caused a 1.4- to 2-fold increase of S. mutans Gtf-B sucrase activity and a 3- to 6-fold increase in transferase activity"

    • Experimental approach: Compare the effects of wild-type versus lgt-deficient S. gordonii on S. mutans Gtf activity and subsequent biofilm formation

  • Competitive advantage:

    • Proper lipoprotein processing by lgt may confer competitive advantages to S. gordonii in mixed communities

    • Experimental approach: Perform competition assays between wild-type and lgt-deficient S. gordonii in the presence of other oral bacteria under various nutrient conditions

Understanding these interactions is crucial for developing ecological approaches to managing oral diseases associated with polymicrobial biofilms.

What are the emerging techniques for studying lgt function in S. gordonii?

Several cutting-edge technologies are emerging as powerful tools for investigating lgt function in S. gordonii:

  • CRISPR-Cas9 genome editing:

    • Enables precise modification of the lgt gene and its regulatory elements

    • Allows creation of conditional knockdowns using inducible CRISPR interference

    • Facilitates high-throughput screening of lgt interactions with other genes through CRISPR libraries

  • Single-cell techniques:

    • Single-cell RNA-seq to examine heterogeneity in responses to lgt mutation

    • Microfluidic devices for analyzing individual bacterial behavior in controlled environments

    • Live-cell imaging with fluorescent lipoprotein reporters to track processing in real-time

  • Advanced microscopy:

    • Super-resolution microscopy to visualize lgt localization within bacterial cells

    • FRET-based assays to study lgt-substrate interactions in living cells

    • Correlative light and electron microscopy to connect lgt activity with ultrastructural features

  • Synthetic biology approaches:

    • Designer lipoproteins with non-natural amino acids for tracking and manipulation

    • Reconstitution of minimal lipoprotein processing systems in liposomes

    • Engineering orthogonal lgt variants with altered substrate specificity

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Machine learning algorithms to predict lipoprotein function and processing

    • Network analysis to position lgt within the broader context of bacterial physiology

These emerging techniques promise to advance our understanding of lgt function beyond what conventional approaches have revealed, potentially uncovering novel therapeutic targets.

How might inhibition of S. gordonii lgt be exploited for therapeutic development?

The critical role of lgt in S. gordonii pathogenesis makes it an attractive target for novel therapeutic approaches:

  • Structure-based drug design:

    • Utilize structural information about lgt's active site to design specific inhibitors

    • Develop transition-state analogs that competitively inhibit the diacylglycerol transfer reaction

    • Screen virtual libraries for compounds that bind to catalytic residues

  • Anti-virulence approach:

    • Since lgt-deficient S. gordonii maintains viability while showing reduced virulence , lgt inhibitors could potentially reduce pathogenicity without selecting for resistance

    • Target lgt-dependent lipoproteins involved in adherence to prevent colonization

    • Disrupt lgt-dependent immune evasion mechanisms

  • Combination therapies:

    • Pair lgt inhibitors with conventional antibiotics for synergistic effects

    • Combine with other anti-virulence compounds targeting different pathways

    • Use with probiotics to facilitate displacement of S. gordonii from pathogenic niches

  • Delivery strategies:

    • Develop topical formulations for oral application to prevent endocarditis in high-risk patients

    • Design controlled-release systems for maintaining effective inhibitor concentrations

    • Explore targeted nanoparticle delivery to sites of S. gordonii colonization

  • Potential challenges and considerations:

    • Ensuring specificity for S. gordonii lgt over host enzymes and beneficial microbiota

    • Addressing potential compensatory mechanisms that might emerge

    • Optimizing pharmacokinetic properties for relevant infection sites

The development of lgt inhibitors represents a promising strategy for controlling S. gordonii-associated infections while potentially minimizing disruption to the commensal microbiota.

What controversies exist in the current understanding of S. gordonii lgt function?

Despite significant research, several controversies and knowledge gaps persist regarding S. gordonii lgt function:

  • Essentiality discrepancy:

    • While lgt appears non-essential for S. gordonii growth in laboratory conditions , this contradicts findings in some other bacterial species

    • Controversy exists over whether lgt becomes essential under specific environmental stresses or in vivo conditions

    • Experimental approach: Conduct conditional essentiality screens across diverse environmental conditions

  • Mechanism of immune activation:

    • Debate persists about whether lipoproteins processed by lgt are the primary immune activators in S. gordonii or if other cell wall components contribute significantly

    • The search results indicate that "lipoproteins are considered as more potent stimulators of TLR2 than LTA in S. gordonii" , but the relative contribution remains controversial

    • Experimental approach: Conduct comparative immune stimulation studies with purified components and determine dose-dependent effects

  • Functional redundancy:

    • Questions remain about potential backup mechanisms that might compensate for lgt deficiency

    • The observation that S. gordonii lgt mutants show no growth defects raises questions about alternative lipoprotein processing pathways

    • Experimental approach: Perform suppressor screens to identify genes that become essential in lgt-deficient backgrounds

  • Substrate specificity determinants:

    • The molecular basis for how lgt recognizes specific lipoprotein substrates remains incompletely understood

    • Controversy exists over whether sequence motifs beyond the lipobox influence processing efficiency

    • Experimental approach: Conduct systematic mutagenesis of lipoprotein signal sequences and quantify effects on processing

  • Clinical relevance in polymicrobial infections:

    • The importance of lgt in the context of complex polymicrobial infections, where S. gordonii interacts with multiple species, remains debated

    • Experimental approach: Develop polymicrobial infection models to assess the contribution of lgt to S. gordonii persistence in complex communities

Addressing these controversies requires innovative experimental approaches and may lead to paradigm shifts in our understanding of bacterial lipoprotein processing and function.

What are the key methodological considerations for researchers working with recombinant S. gordonii lgt?

Researchers working with recombinant S. gordonii lgt should consider several critical methodological factors to ensure successful experiments:

  • Protein stability and solubility:

    • lgt is a membrane-associated enzyme that may present solubility challenges

    • Consider using detergent solubilization (mild non-ionic detergents like DDM or CHAPS)

    • Explore fusion partners (MBP, SUMO) to enhance solubility

    • Optimize buffer conditions to maintain enzyme stability during purification and storage

  • Substrate preparation:

    • Synthetic peptides representing lipobox motifs should be designed based on known S. gordonii lipoproteins

    • Consider using native lipoproteins extracted from S. gordonii as substrates for more physiologically relevant assays

    • Ensure lipid donors (diacylglycerols) are pure and properly solubilized

  • Activity preservation:

    • Maintain reducing conditions to protect catalytic cysteine residues

    • Use glycerol (10-20%) in storage buffers to prevent freeze-thaw damage

    • Validate enzyme activity after each purification step

    • Consider immobilization strategies for enhanced stability in applied settings

  • Controls and validation:

    • Include catalytically inactive mutants (site-directed mutagenesis of key residues) as negative controls

    • Use known lgt substrates from related species as positive controls

    • Validate results using complementary assay methods

    • Confirm that recombinant enzyme behavior reflects native enzyme activity

  • Scalability considerations:

    • Optimize expression conditions for increased yield while maintaining proper folding

    • Consider automated purification systems for consistency across preparations

    • Develop activity assays amenable to high-throughput screening if inhibitor discovery is a goal

These methodological considerations are essential for generating reliable and reproducible data when working with this challenging but important bacterial enzyme.

How should researchers interpret contradictory data regarding lgt function across different experimental systems?

When faced with contradictory data about S. gordonii lgt function, researchers should employ these analytical and experimental strategies:

  • Systematic comparison of experimental conditions:

    • Create a detailed table comparing growth media, temperature, oxygen levels, growth phase, and other variables across studies

    • Identify key differences that might explain contradictory results

    • Systematically test these variables in controlled experiments

  • Strain validation and characterization:

    • Confirm genetic background of all strains through whole genome sequencing

    • Verify lgt mutation by both genotypic and phenotypic methods

    • Check for unintended secondary mutations that might affect results

    • Evaluate potential compensatory mechanisms that may have evolved

  • Methodological standardization:

    • Develop standardized protocols for key assays (enzymatic activity, virulence assessment)

    • Conduct inter-laboratory validation studies

    • Establish agreed-upon positive and negative controls

    • Create reference datasets for calibration of new studies

  • Integrated multi-omics approach:

    • Apply transcriptomics, proteomics, and metabolomics to the same experimental system

    • Identify potential explanations for contradictions at different biological levels

    • Look for conditional effects that depend on specific environmental triggers

  • Mathematical modeling:

    • Develop models that incorporate contradictory data and identify parameters that reconcile differences

    • Use sensitivity analysis to determine which experimental variables most strongly influence outcomes

    • Generate testable predictions to resolve contradictions

By systematically addressing contradictions through these approaches, researchers can develop a more nuanced understanding of S. gordonii lgt function that accommodates seemingly conflicting observations within a coherent theoretical framework.

What are the ethical considerations in developing therapeutic strategies targeting S. gordonii lgt?

The development of therapeutic strategies targeting S. gordonii lgt raises several important ethical considerations:

  • Microbiome disruption risks:

    • S. gordonii is a normal component of the oral microbiome with potential beneficial roles

    • Therapies targeting lgt must consider potential ecological disruptions

    • Research should include comprehensive assessment of effects on beneficial microbiota

    • Development of highly specific inhibitors that minimize impact on commensal bacteria

  • Resistance development and management:

    • Even anti-virulence approaches targeting lgt may select for resistance

    • Ethical obligation to investigate resistance mechanisms preemptively

    • Development of resistance surveillance protocols as part of therapeutic development

    • Consideration of combination approaches to minimize resistance emergence

  • Translational research ethics:

    • Appropriate progression from in vitro to animal models to human studies

    • Careful selection of animal models that best recapitulate human disease

    • Transparent reporting of both positive and negative results

    • Addressing reproducibility concerns through robust study design and open data sharing

  • Access and equity considerations:

    • Ensuring therapeutic approaches are developed with global accessibility in mind

    • Considering cost implications for treatments targeting diseases that disproportionately affect underserved populations

    • Engaging diverse stakeholders in setting research priorities

  • One Health perspective:

    • Considering potential environmental impacts of lgt-targeting therapies

    • Evaluating potential effects on animal microbiomes if therapies enter environmental reservoirs

    • Developing responsible disposal protocols for research materials and therapeutic agents

These ethical considerations should be integrated throughout the research and development process, from basic investigations of lgt function through translation to clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.