Recombinant Streptococcus gordonii Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Recombinant Streptococcus gordonii undecaprenyl-diphosphatase (UppP) is an engineered enzyme derived from the bacterial species S. gordonii. UppP catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a critical lipid carrier molecule essential for bacterial cell wall biogenesis . This enzyme is annotated as EC 3.6.1.27 and functions as a bacitracin resistance protein by recycling UPP, thereby sustaining peptidoglycan and teichoic acid biosynthesis .

Key Features

PropertyDetail
Gene NameuppP
UniProt IDA8AYY7
Recombinant SourceYeast expression system
Purity>85% (SDS-PAGE)
Molecular FunctionUPP dephosphorylation, bacitracin resistance
Biological ProcessCell wall biogenesis, lipid carrier recycling

The recombinant enzyme retains native catalytic activity, enabling functional studies in heterologous systems . Structural homology analyses reveal conserved motifs with other bacterial UppP homologs, particularly in Gram-positive pathogens like Streptococcus mutans and Bacillus subtilis .

Role in Cell Wall Biogenesis

UppP-deficient strains of S. mutans exhibit severe defects in cell division, altered morphology, and reduced biofilm formation, underscoring its essential role in cell envelope integrity . In B. subtilis, UppP is critical for sporulation and lipid II cycle maintenance, with deletion mutants showing a 99.96% reduction in heat-resistant spores .

Antibiotic Resistance

UppP confers bacitracin resistance by competing with the antibiotic for UPP binding. Strains lacking UppP show increased sensitivity to bacitracin (MIC reduced by >50%) . This property has been exploited to study bacitracin’s mode of action and develop resistance-bypassing strategies .

Recombinant Production

Recombinant UppP from S. gordonii is produced in yeast systems with high purity (>85%) and stability. Key parameters include:

  • Expression Vector: Plasmid-based systems with optimized promoters .

  • Yield: ~8.6 μg/ml in culture supernatants under standardized conditions .

  • Applications: Functional assays, structural studies, and antibiotic resistance screens .

Genomic and Transcriptional Insights

The uppP gene in S. gordonii is part of a conserved operon flanked by genes encoding hypothetical proteins and Suf iron-sulfur cluster assembly factors . Northern blot analyses confirm that recombinant uppP is transcribed as part of larger polycistronic units, with minimal disruption to native genomic organization .

Comparative Analysis Across Species

SpeciesUppP FunctionPhenotype of UppP Deficiency
S. gordoniiUPP recycling, bacitracin resistanceReduced biofilm formation, cell division defects
S. mutansCell envelope integrityMembrane permeability defects, acid sensitivity
B. subtilisSporulation, lipid II cycle maintenancePhase-gray spores, sporulation failure

Future Directions

Recombinant UppP is a promising target for:

  • Antibiotic Adjuvants: Restoring bacitracin efficacy in resistant strains .

  • Synthetic Biology: Engineering S. gordonii as a delivery vector for antimicrobial peptides .

  • Structural Studies: Resolving enzyme mechanisms to inform drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference by customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development according to your request.
Synonyms
uppP; SGO_1725; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Target Names
uppP
Target Protein Sequence
MFFIEIIKSVIFGIIEGITEWLPISSTGHLILVQEFIHYQKQNAAFMEMFNVVIQLGAIL AVVFIYFDKLNPFKPDKTPRQVQKTWQLWAKVVVASLPAVIIGIPLDNWFEKNFHNFVSV AIMLIIYGIAFILIERRNQEVEPTVTNLEKLPYKTALYIGFFQVLSLFPGTSRSGATIVG GLLNGTSRSVVTEFTFFLGIPVMFGASGIKVLKFILKGNSLDLGQLTLLLVAMIVAFGVS MYVIRFLTDYVKKHDFTVFGKYRIGLGALLLIYWVFKALFAK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in Streptococcus gordonii?

Undecaprenyl-diphosphatase (uppP) is an essential membrane enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to generate undecaprenyl phosphate (UP), a critical lipid carrier required for the biosynthesis of peptidoglycan and various surface polymers in bacterial cell walls. In Streptococcus species, including S. gordonii, uppP plays a crucial role in cell envelope biogenesis by recycling the lipid carrier, which is necessary for the transport of cell wall precursors across the cytoplasmic membrane. The enzyme is also known to confer resistance to bacitracin, an antibiotic that specifically binds to UPP .

What is the relationship between uppP and bacterial antimicrobial resistance?

UppP has been demonstrated to confer resistance to bacitracin, an antibiotic that targets cell wall synthesis. Studies in S. mutans have shown that strains with deletion of uppP exhibited a weakened tolerance to bacitracin, highlighting its role in antimicrobial resistance. Additionally, uppP activity affects cell membrane integrity, potentially influencing susceptibility to other membrane-targeting antimicrobials. The enzyme's role in recycling undecaprenyl phosphate makes it crucial for maintaining cell wall biogenesis under antibiotic stress conditions .

What expression systems are most effective for producing active recombinant S. gordonii uppP?

For successful expression of recombinant S. gordonii uppP, a strategy similar to that used for other membrane-associated streptococcal proteins is recommended:

Expression System Recommendations:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, established protocolsMay require codon optimization for streptococcal genes
E. coli C43(DE3)Optimized for membrane proteinsBetter for membrane protein folding
S. gordonii homologousNative folding environmentLower yields, more complex system

When designing the expression construct, consider incorporating:

  • A cleavable N-terminal signal peptide for proper membrane insertion

  • A C-terminal His6-tag for purification

  • A TEV protease cleavage site for tag removal if needed for activity studies

Optimal expression is typically achieved at lower temperatures (16-25°C) with reduced inducer concentrations to allow proper folding of the membrane protein .

What are the most effective purification strategies for recombinant uppP?

Purification of recombinant uppP requires careful consideration of its membrane-associated nature:

Purification Protocol:

  • Cell lysis: Use gentle techniques such as enzymatic lysis with lysozyme followed by mild sonication

  • Membrane extraction: Solubilize membranes with appropriate detergents (e.g., DDM, CHAPS, or Triton X-100)

  • Affinity chromatography: Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Size exclusion chromatography: Remove aggregates and further purify the protein

The choice of detergent is critical for maintaining enzyme activity. Consider screening multiple detergents for optimal solubilization while preserving enzymatic function. For activity studies, reconstitution into liposomes may be necessary to provide a native-like membrane environment .

How can proper folding and activity of recombinant uppP be verified?

Verification of proper folding and enzymatic activity is essential for recombinant uppP research:

Activity Verification Methods:

  • Enzymatic assay: Measure the release of inorganic phosphate from undecaprenyl diphosphate substrate

  • Circular dichroism (CD) spectroscopy: Assess secondary structure composition

  • Thermal shift assay: Evaluate protein stability and folding

  • Functional complementation: Test if the recombinant protein can restore bacitracin resistance in uppP-deficient strains

For enzymatic assays, a coupled assay system using malachite green can detect released phosphate, or HPLC methods can be used to directly monitor substrate conversion. Confirming that the recombinant enzyme confers bacitracin resistance when expressed in a uppP-deficient strain provides strong evidence of proper folding and activity .

What biochemical assays can accurately measure undecaprenyl-diphosphatase activity?

Several methodologies can be employed to measure the enzymatic activity of recombinant uppP:

Enzymatic Assay Methods:

Assay TypeMethodologyAdvantagesLimitations
ColorimetricMalachite green phosphate detectionSimple, quantitativeIndirect measure
Radiometric32P-labeled substrateHigh sensitivityRequires radioactive handling
HPLCDirect substrate/product measurementDirect quantificationRequires specialized equipment
MS-basedMass spectrometry detectionHigh sensitivity, specificityComplex analysis

A standard reaction typically contains purified recombinant uppP (1-5 μg), undecaprenyl diphosphate substrate (50-100 μM), in a buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 0.1% appropriate detergent. Reactions are typically incubated at 37°C for 30-60 minutes and stopped with EDTA before measurement .

How does uppP activity impact cell wall biogenesis pathways?

UppP activity directly affects the recycling of undecaprenyl phosphate, which serves as a lipid carrier for cell wall precursors. Studies in related streptococci have shown that:

  • UppP catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to regenerate undecaprenyl phosphate (UP)

  • UP serves as a carrier for cell wall precursors including peptidoglycan subunits and rhamnose-glucose polysaccharide (RGP) components

  • Impaired uppP function leads to reduced availability of UP, affecting multiple cell wall biosynthesis pathways

The interconnection between uppP and cell wall biogenesis is evidenced by the proximity of uppP to the rgpG gene in the genome, where rgpG encodes the first enzyme in the RGP biosynthesis pathway. Studies in S. mutans have shown that deficiency in uppP leads to reduced biofilm formation, suggesting its impact on extracellular matrix production and cell surface properties .

What factors affect the enzymatic properties of recombinant uppP?

Several factors significantly influence the enzymatic activity of recombinant uppP:

Critical Factors Affecting uppP Activity:

  • Detergent environment: Nature and concentration of detergents affect enzyme conformation and substrate accessibility

  • pH: Optimal activity typically observed between pH 6.5-7.5

  • Divalent cations: Mg2+ or Mn2+ may enhance activity

  • Membrane lipid composition: Phospholipid environment influences enzyme activity

  • Temperature: Activity optimum typically near physiological temperature (37°C)

When designing experiments with recombinant uppP, consider screening these parameters to establish optimal conditions. The enzyme's membrane-associated nature makes it particularly sensitive to its lipid environment, which may necessitate reconstitution in liposomes of defined composition for consistent activity measurements .

How can structural biology approaches elucidate uppP's catalytic mechanism?

Structural biology techniques offer valuable insights into uppP's mechanism:

Structural Biology Approaches:

  • X-ray crystallography: Can provide high-resolution structures but challenging for membrane proteins

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination

  • Nuclear magnetic resonance (NMR): Suitable for dynamics studies and smaller domains

  • Molecular dynamics simulations: Can model protein-lipid interactions and catalytic mechanism

Recent advances in membrane protein structural biology, such as lipidic cubic phase crystallization and nanodiscs for cryo-EM, have improved success rates. For uppP, consider:

  • Using thermostabilized variants for crystallization attempts

  • Nanodiscs or amphipols for cryo-EM studies

  • Focused studies on active site residues using site-directed mutagenesis

Combining structural data with kinetic measurements of mutant variants can elucidate the catalytic mechanism. Comparative analysis with related phosphatases like PgpB can provide additional insights into the catalytic mechanism .

How does uppP contribute to bacterial stress responses?

UppP plays significant roles in bacterial stress responses:

  • Antibiotic stress: UppP confers resistance to bacitracin by regenerating UP, preventing the antibiotic from binding to its target UPP

  • Membrane stress: UppP activity maintains membrane homeostasis during detergent exposure

  • Acid stress: Potential involvement in acid tolerance response through maintenance of membrane integrity

Research in S. mutans has shown that uppP-deficient strains exhibit increased sensitivity to membrane-targeting compounds like SDS, suggesting a broader role in maintaining membrane integrity under stress conditions. To study these responses, researchers can expose recombinant uppP-expressing strains to various stressors and monitor survival, membrane integrity, and cell wall synthesis rates .

What are the interactions between uppP and other cell envelope biogenesis enzymes?

Understanding uppP's interactions with other enzymes provides insights into coordinated cell wall synthesis:

Potential Interaction Partners:

  • MurG: Transfers GlcNAc to lipid I to form lipid II, utilizing the same undecaprenyl phosphate carrier

  • RgpG: First enzyme in RGP biosynthesis pathway, genetically linked to uppP

  • Penicillin-binding proteins (PBPs): Use lipid II for peptidoglycan synthesis

  • MecA/ClpCP protease complex: May regulate uppP levels or activity

To identify these interactions, researchers can employ:

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation followed by mass spectrometry

  • Crosslinking studies

  • Fluorescence resonance energy transfer (FRET) with fluorescently labeled proteins

The genomic organization in streptococci suggests functional relationships between uppP and downstream genes. In S. mutans, uppP is located upstream of mecA, which encodes an adaptor protein for ClpC protease. This proximity suggests potential regulatory interactions between cell wall synthesis and protein quality control systems .

What are common challenges in expressing and purifying functional recombinant uppP?

Researchers frequently encounter several challenges when working with recombinant uppP:

Common Challenges and Solutions:

ChallengePotential CauseSolutions
Low expression yieldToxicity, codon biasUse controlled expression, codon optimization
Inclusion body formationImproper foldingLower induction temperature, use solubility tags
Loss of activity during purificationDetergent effectsScreen detergents, maintain critical lipids
AggregationHydrophobic interactionsAdd stabilizers, optimize buffer conditions
Variable activity measurementsAssay conditionsStandardize substrate preparation, enzyme concentration

The membrane-associated nature of uppP makes it particularly challenging. Consider using fusion partners like MBP (maltose-binding protein) to enhance solubility, and screen multiple detergents at various concentrations to optimize extraction and purification conditions. For long-term storage, glycerol addition (10-20%) and storage at -80°C in small aliquots helps maintain activity .

How can genetic manipulation studies of uppP be designed in Streptococcus gordonii?

To study uppP function through genetic manipulation in S. gordonii:

Genetic Manipulation Strategies:

  • Gene knockout: Create precise deletions using allelic exchange methods

    • Design primers to amplify ~1 kb regions flanking uppP

    • Clone flanking regions around a selectable marker (e.g., erythromycin resistance)

    • Transform S. gordonii with the construct and select for double crossover events

  • Complementation studies:

    • Clone the wild-type uppP gene under a controllable promoter

    • Integrate at a neutral site or use a shuttle vector

    • Express in the knockout strain to confirm phenotype rescue

  • Site-directed mutagenesis:

    • Introduce specific mutations in conserved residues

    • Express mutant variants in the knockout background

    • Assess effects on enzyme activity and cellular phenotypes

  • Reporter fusions:

    • Create translational fusions with luciferase or fluorescent proteins

    • Monitor expression under various growth conditions

When designing these experiments, controls should include measuring bacitracin sensitivity, biofilm formation capacity, and cell morphology to comprehensively characterize phenotypic changes .

How does uppP research contribute to understanding bacterial antimicrobial resistance mechanisms?

UppP research provides valuable insights into intrinsic resistance mechanisms:

  • Bacitracin resistance: UppP activity directly counters bacitracin's mechanism of action by regenerating UP from UPP, the antibiotic's target

  • Cell wall synthesis inhibitors: Understanding uppP function helps explain bacterial responses to various cell wall-targeting antibiotics

  • Membrane perturbation: UppP's role in maintaining membrane integrity influences response to membrane-active antimicrobials

Research approaches to study these connections include:

  • Determining minimum inhibitory concentrations (MICs) of various antibiotics in wild-type versus uppP-modified strains

  • Measuring cell wall precursor accumulation under antibiotic stress

  • Assessing membrane permeability changes in response to antimicrobial exposure

The development of specific uppP inhibitors could potentially synergize with existing antibiotics, particularly those targeting cell wall biosynthesis pathways .

What role does uppP play in Streptococcus gordonii biofilm formation?

Studies in related streptococci suggest uppP significantly impacts biofilm formation:

  • Lipid carrier recycling: UppP activity ensures sufficient UP availability for synthesizing extracellular polysaccharides

  • Cell surface properties: Changes in cell wall composition affect initial attachment to surfaces

  • Stress responses: UppP-mediated stress tolerance influences bacterial survival in biofilms

To investigate uppP's role in S. gordonii biofilm formation:

  • Compare biofilm formation capacity between wild-type and uppP-deficient strains

  • Analyze extracellular matrix composition using biochemical and microscopic methods

  • Assess gene expression patterns in biofilms versus planktonic cells

  • Evaluate the effects of sub-inhibitory concentrations of bacitracin on biofilm development

Understanding uppP's role in biofilm formation has implications for developing strategies to control streptococcal biofilms in both clinical and industrial settings .

What emerging technologies could advance uppP research?

Several cutting-edge technologies show promise for uppP research:

Emerging Technologies for uppP Research:

  • CRISPR-Cas9 gene editing:

    • Precise genomic modifications in streptococci

    • Introduction of point mutations at endogenous loci

    • Creation of conditional knockdowns

  • Single-molecule enzymology:

    • Direct observation of uppP activity at the single-molecule level

    • Characterization of enzyme dynamics and heterogeneity

  • Microfluidics-based approaches:

    • High-throughput screening of uppP variants or inhibitors

    • Real-time monitoring of bacterial responses to uppP modulation

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Identification of interacting partners and lipid preferences

  • Cryo-electron tomography:

    • Visualization of uppP localization in the bacterial membrane

    • Understanding spatial organization relative to cell wall synthesis machinery

These technologies could reveal new aspects of uppP function, regulation, and interactions, potentially leading to novel antimicrobial strategies targeting this essential enzyme .

How might comparative genomics inform our understanding of uppP across bacterial species?

Comparative genomics approaches offer valuable insights:

  • Sequence conservation analysis: Identifying highly conserved residues that may be essential for function

  • Genomic context examination: Revealing conserved gene neighborhoods suggesting functional relationships

  • Evolutionary rate analysis: Understanding selective pressures on uppP across bacterial lineages

  • Horizontal gene transfer assessment: Evaluating possible acquisition of resistance-related variants

Current data suggests high conservation of uppP and its genomic context across streptococci, indicating its fundamental importance. Future research could explore differences in uppP sequence, expression, and activity between pathogenic and commensal streptococci, potentially revealing adaptations related to their respective ecological niches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.