Recombinant Streptococcus phage Cp-1 Holin (CPH1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Streptococcus Phage Cp-1 Holin (CPH1)

Recombinant Streptococcus phage Cp-1 Holin (CPH1) is a protein encoded by the cph1 gene of the bacteriophage Cp-1, which infects Streptococcus pneumoniae. This protein belongs to the family of holins, which are essential components in the lysis process of bacterial cells infected by bacteriophages. Holins create lesions in the bacterial cell membrane, allowing endolysins to access and degrade the peptidoglycan layer, leading to cell lysis and the release of phage progeny .

Structure and Function of CPH1

CPH1 is a small protein consisting of 134 amino acids with a molecular weight of approximately 15.4 kDa . It exhibits characteristics typical of holin proteins, such as the ability to form pores in bacterial membranes. The cph1 gene is located upstream of the cpl1 gene, which encodes for a lysozyme (endolysin) in the Cp-1 phage genome. The stop codon of cph1 overlaps with the start codon of cpl1, a common feature in two-component phage lytic systems .

Complementation Studies

CPH1 can complement a lambda Sam mutation in E. coli, which is a lysis-defective mutant. This suggests that CPH1 has functional similarities with the holin encoded by the lambda phage, further supporting its role in membrane disruption .

Research Findings and Implications

The study of CPH1 provides insights into the mechanisms of phage-mediated lysis and has potential applications in the development of novel antimicrobial strategies. By understanding how holins and endolysins work together, researchers can explore new ways to combat bacterial infections, particularly those caused by antibiotic-resistant strains.

Table 1: Key Features of CPH1

FeatureDescription
Genecph1
Protein Size134 amino acids
Molecular WeightApproximately 15.4 kDa
FunctionCreates lesions in bacterial membranes
ExpressionCauses cell death but not lysis when expressed alone in E. coli
Co-expression with Cpl1Leads to efficient lysis of E. coli cells

Table 2: Comparison of Holin Functions

HolinSourceFunction
CPH1Cp-1 phageCreates lesions in bacterial membranes, facilitating endolysin access
Lambda SLambda phageEssential for lysis by creating pores in the membrane

References Functional Analysis of the Two-Gene Lysis System of the Streptococcus pneumoniae Bacteriophage Cp-1. Analysis of the complete nucleotide sequence and functional organization of the genome of bacteriophage Cp-1, a virus infecting Streptococcus pneumoniae. Recombinant bacteriophage lysins as antibacterials.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, specify your required tag type at the time of order for preferential development.
Synonyms
CPH1; 21; Holin; Lysis protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-134
Protein Length
full length protein
Species
Streptococcus phage Cp-1 (Bacteriophage Cp-1)
Target Names
CPH1
Target Protein Sequence
MLYNIMLEVAKGDYITILFALILFDFITGFLKAWKWKVTDSWTGLKGVIKHTLTFIFYYF VAVFLTYIHAMAVGQILLVIINLYYALSIMENLAVMGVFIPKFMTARVQEELQKYTAQLD AGKDLLEEFKGEKK
Uniprot No.

Target Background

Function
Creates a lesion in the cytoplasmic membrane, enabling phage lysozyme to degrade the peptidoglycan.
Database Links

KEGG: vg:1261217

Protein Families
Cp-1 holin family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.