Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
Description
Definition and Overview of Recombinant Streptococcus pneumoniae ATP Synthase Subunit c (atpE)
Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) is a bioengineered protein derived from the bacterium Streptococcus pneumoniae. It represents the membrane-bound c-subunit of the F₀F₁ ATP synthase, an essential enzyme for converting proton gradients into ATP during oxidative phosphorylation. The recombinant form is typically expressed in heterologous systems (e.g., E. coli) with modifications such as N-terminal His-tags for purification and solubility enhancement .
Primary Structure
-
Amino Acid Sequence: The full-length protein (1–66 residues) includes the conserved motif for proton translocation: MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK .
-
UniProt IDs: Strain-specific variants include B2IQX6 (strain D39) and C1CLL2 (strain P1031) .
-
Tag: N-terminal His-tag (6xHis) for affinity chromatography .
Functional Role
-
Proton Conductance: As part of the F₀ sector, subunit c oligomerizes (c₁₀ ring) to form a proton channel, enabling proton translocation across the membrane .
-
ATP Synthesis: Coupled with subunit a and the F₁ sector, it drives ATP production via rotational catalysis .
Antibiotic Targeting
Mutations in atpE (e.g., V48I, V60A) confer resistance to diarylquinoline antibiotics, which inhibit proton flow through subunit c. These mutations increase minimum inhibitory concentrations (MICs) by >100-fold in S. pneumoniae . Surface plasmon resonance (SPR) studies confirm direct binding of small-molecule inhibitors to purified subunit c .
Biofilm Disruption
Subunit c inhibitors reduce biofilm formation in S. pneumoniae and S. aureus, highlighting its role in microbial persistence .
Vaccine Development
The protein is explored as a vaccine antigen due to its conserved sequence across Streptococcus serotypes. Recombinant atpE is used in immunogenicity studies to induce protective immune responses .
Industrial and Research Providers
-
Creative Biomart: Offers His-tagged recombinant atpE (Cat. No. RFL27869SF, RFL28915SF) .
-
Creative Biolabs: Provides strain-specific variants (e.g., Hungary19A-6) for vaccine research .
-
Cusabio: Supplies partial-length atpE for biochemical assays .
Resistance Mutations
Point mutations (e.g., V48I, V60A) in atpE reduce inhibitor efficacy, necessitating combination therapies or next-generation drug designs .
Protein Stability
Repeated freeze-thaw cycles degrade activity, requiring careful aliquoting and storage at -20°C/-80°C .
Cross-Species Specificity
Subunit c sequences differ between Gram-positive (e.g., S. pneumoniae) and Gram-negative bacteria (e.g., E. coli), limiting broad-spectrum antibiotic applications .
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional charges will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: spr:spr1366
STRING: 171101.spr1366
