Recombinant Streptococcus pneumoniae DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to DNA Translocase FtsK

Filament temperature-sensitive mutant K (FtsK) functions as a conserved DNA motor protein that plays essential roles in bacterial chromosome segregation and cell division. In bacterial species, FtsK serves as a DNA pump that helps clear trapped DNA at the septum during cell division, ensuring complete genomic segregation between daughter cells . This protein belongs to the FtsK/SpoIIIE family of DNA translocases, which are widely conserved across bacterial species, highlighting their fundamental importance to prokaryotic life cycles. FtsK coordinates with other divisome components to ensure proper chromosome segregation and cell division.

S. pneumoniae employs FtsK as part of its essential cellular machinery for proper genome maintenance and reproductive processes. The recombinant expression of S. pneumoniae FtsK has facilitated detailed investigation of this protein's properties outside its native environment . By expressing the protein in heterologous systems like Escherichia coli, researchers can produce sufficient quantities of purified protein for comprehensive structural, biochemical, and functional studies, advancing our understanding of bacterial chromosome segregation mechanisms and identifying potential therapeutic targets.

Like other DNA motor proteins, FtsK uses the energy from ATP hydrolysis to translocate DNA, particularly during the final stages of cell division when chromosomes need to be properly segregated to daughter cells. The directionality of this translocation is guided by specific DNA sequences that are asymmetrically distributed on the bacterial chromosome, serving as orientation markers for FtsK movement .

Protein Structure and Domains

The recombinant full-length Streptococcus pneumoniae DNA translocase FtsK protein consists of 767 amino acids (UniProt accession P64167) and is typically expressed with an N-terminal histidine tag to facilitate purification . While the specific domain organization of S. pneumoniae FtsK is not explicitly detailed in available research, FtsK proteins generally contain three main functional domains that contribute to their complex biological roles.

The N-terminal domain anchors the protein to the cell membrane and interacts with other divisome components, positioning FtsK at the site of cell division. The central linker domain connects the N-terminal and C-terminal regions, providing flexibility for the protein to function effectively while maintaining its membrane association. The C-terminal domain possesses the ATP-dependent DNA translocase activity critical for chromosome segregation.

The C-terminal region is further subdivided into three subdomains: α and β subdomains that form the ATP-dependent motor that drives DNA translocation, and the γ subdomain that recognizes specific DNA sequences and interacts with DNA recombinases . This γ subdomain is particularly important for FtsK's role in chromosome dimer resolution, as it activates site-specific recombination through interaction with recombinases such as XerD.

Expression Systems and Methods

Recombinant S. pneumoniae FtsK is typically expressed in Escherichia coli expression systems, which provide a robust platform for producing bacterial proteins in high yields . The recombinant construct includes the full-length ftsK gene fused to an N-terminal histidine tag. This heterologous expression system offers several advantages, including high protein yields, established protocols for induction and harvesting, and compatibility with various purification approaches.

The expression process generally involves transforming E. coli cells with a plasmid containing the His-tagged S. pneumoniae ftsK gene, followed by culture growth and protein expression induction. After sufficient expression, the bacterial cells are harvested, and the recombinant protein is extracted for subsequent purification steps.

Role in Chromosome Segregation

FtsK functions as a DNA motor protein that coordinates genome segregation during bacterial cell division . During this process, FtsK helps ensure that chromosomal DNA is properly segregated between daughter cells by clearing DNA trapped in the division septum. This function is critical for the accurate distribution of the bacterial genome during the final stages of cell division.

Studies have shown that FtsK forms multiple foci on both the nucleoid (bacterial chromosome) and the cell membrane, with the highest density observed at the septum . This localization pattern aligns with its role in DNA segregation at the division site. FtsK coordinates its movement with nucleoid separation, and its foci shift from the old to the new septum, indicating its dynamic behavior during the cell division process .

DNA Translocation Mechanism

As a DNA motor protein, FtsK uses ATP hydrolysis to power the directional movement of DNA. The protein's ATP-dependent motor activity allows it to pump DNA through the closing septum during cell division, ensuring that chromosomal DNA doesn't get trapped and improperly segregated during cell division.

The direction of FtsK-mediated DNA translocation is guided by specific DNA sequences called FtsK-Orienting Polar Sequences (KOPS) or SRS (SpoIIIE Recognition Sequences) . These motifs are distributed asymmetrically on the chromosome and serve as orientation markers that direct FtsK movement toward the terminus region of the chromosome. While the specific recognition sequences for S. pneumoniae FtsK are not fully characterized, research with other bacterial species indicates that these recognition motifs can vary between species, suggesting evolutionary adaptations of FtsK to specific genomic contexts .

Interaction with Chromosome Dimer Resolution Systems

Another critical function of FtsK is its role in chromosome dimer resolution (CDR). During bacterial replication, homologous recombination events can sometimes result in chromosome dimers that must be resolved before cell division can be completed. FtsK helps resolve these dimers by activating site-specific recombination at the dif site in the terminus region of the chromosome .

In this process, FtsK brings together two dif sites and activates tyrosine recombinases (typically XerCD) to form a synaptic complex that performs site-specific recombination to resolve the chromosome dimers . The γ subdomain of FtsK is particularly important for this function, as it recognizes and interacts with these recombinases, stimulating their activity at the appropriate location and time during the cell cycle.

Compensatory Functions

An interesting aspect of FtsK function revealed in recent research is its ability to compensate for the loss of other chromosome organization factors. For instance, in Corynebacterium glutamicum, FtsK can compensate for the loss of the Structural Maintenance of Chromosomes (SMC) complex, which normally plays a crucial role in chromosome organization . In cells lacking SMC, there is an earlier onset of pole-to-septum FtsK relocation, suggesting that prolonged FtsK activity can compensate for SMC absence and achieve efficient chromosome segregation .

This compensatory function demonstrates the functional adaptability of FtsK and its importance in maintaining genomic integrity even under suboptimal conditions. This capability suggests potential redundancy in chromosome segregation mechanisms, with FtsK serving as a critical backup system for ensuring proper genomic distribution during cell division.

Basic Research Applications

Recombinant S. pneumoniae FtsK serves as a valuable tool for investigating fundamental aspects of bacterial chromosome segregation and cell division. By studying the biochemical and biophysical properties of purified FtsK, researchers can gain insights into its ATP-dependent motor activity, DNA binding specificity, and interactions with other proteins involved in cell division and DNA metabolism.

The purified protein enables various in vitro assays to study:

  • DNA translocation activity and directionality

  • ATP hydrolysis kinetics and energy coupling

  • Sequence-specific DNA binding characteristics

  • Interactions with recombinases and other divisome components

  • Structural studies using techniques such as X-ray crystallography or cryo-electron microscopy

These basic research applications contribute significantly to our understanding of bacterial cell biology and the molecular mechanisms underlying genome maintenance and segregation in S. pneumoniae and related bacteria.

Potential Therapeutic Applications

S. pneumoniae remains a significant human pathogen responsible for numerous cases of pneumonia, meningitis, and other serious infections worldwide. Given the essential role of FtsK in bacterial cell division, it represents a potential target for developing new antimicrobial agents, particularly important in the context of increasing antibiotic resistance.

Similar bacterial cell division proteins like FtsZ are already being investigated as targets for developing new antibacterial agents . The detailed characterization of recombinant S. pneumoniae FtsK provides a foundation for similar drug discovery efforts targeting this essential DNA translocase. By identifying compounds that specifically inhibit FtsK activity, researchers may develop new antibiotics effective against S. pneumoniae, including drug-resistant strains.

Insights into Bacterial Evolution

The study of FtsK across different bacterial species provides valuable insights into the evolution of essential cellular processes. The variations in DNA recognition motifs and protein interactions between FtsK homologs from different bacteria suggest evolutionary adaptations to specific genomic contexts .

Research on recombinant S. pneumoniae FtsK contributes to this comparative analysis, helping scientists understand how essential cellular machinery has evolved across bacterial lineages. The KOPS recognition sequences that guide FtsK activity show variation between species, with evidence suggesting that different bacteria have either independently acquired different DNA binding specificities or changed specificity during evolution . This evolutionary diversity highlights the adaptability of essential cellular mechanisms to specific genomic architectures and bacterial lifestyles.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; spr0781; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-767
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
ftsK
Target Protein Sequence
MANKNTSTTRRRPSKAELERKEAIQRMLISLGIAILLIFAAFKLGAAGITLYNLIRLLVG SLAYLAIFGLLIYLFFFKWIRKQEGLLSGFFTIFAGLLLIFEAYLVWKYGLDKSVLKGTM AQVVTDLTGFRTTSFAGGGLIGVALYIPTAFLFSNIGTYFIGSILILVGSLLVSPWSVYD IAEFFSRGFAKWWEGHERRKEERFVKQEEKARQKAEKEARLEQEETEKALLDLPPVDMET GEILTEEAVQNLPPIPEEKWVEPEIILPQAELKFPEQEDDSDDEDVQVDFSAKEALEYKL PSLQLFAPDKPKDQSKEKKIVRENIKILEATFASFGIKVTVERAEIGPSVTKYEVKPAVG VRVNRISNLSDDLALALAAKDVRIEAPIPGKSLIGIEVPNSDIATVSFRELWEQSQTKAE NFLEIPLGKAVNGTARAFDLSKMPHLLVAGSTGSGKSVAVNGIIASILMKARPDQVKFMM VDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFAKVGVRNIAGFNAK VEEFNSQSEYKQIPLPFIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQR PSVDVISGLIKANVPSRVAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQ GSFISDDDVERIVNFIKTQADADYDESFDPGEVSENEGEFSDGDAGGDPLFEEAKSLVIE TQKASASMIQRRLSVGFNRATRLMEELEIAGVIGPAEGTKPRKVLQQ
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the difSL recombination site, located within the replication terminus region. This protein is required for activation of the XerS recombinase, enabling chromosome unlinking through recombination.
Database Links

KEGG: spr:spr0781

STRING: 171101.spr0781

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is FtsK in Streptococcus pneumoniae and what is its primary function?

FtsK in Streptococcus pneumoniae is a DNA translocase that plays a crucial role in coordinating chromosome segregation during cell division. Similar to FtsK in other bacteria like Escherichia coli, S. pneumoniae FtsK belongs to the RecA family of ATPases and functions to ensure that chromosomal DNA is properly segregated during the cell division process . The protein assembles into a hexameric ring structure with a central channel through which double-stranded DNA is threaded, allowing for directional translocation of DNA . This activity is essential for clearing DNA from the division septum and ensuring complete chromosome segregation before cell separation.

How does the structure of FtsK relate to its function in S. pneumoniae?

The FtsK protein in S. pneumoniae consists of three primary domains that contribute to its function as a DNA translocase:

  • The N-terminal domain: Anchors the protein to the cell membrane and localizes it to the division septum through interactions with other cell division proteins such as FtsZ .

  • The linker region: Connects the N-terminal domain to the C-terminal motor domain. Unlike E. coli FtsK which has a very long linker, S. pneumoniae FtsK has a comparatively shorter linker region .

  • The C-terminal motor domain: Consists of three subdomains (α, β, and γ):

    • The αβ subdomain forms the hexameric ring structure containing the ATPase machinery

    • The γ domain recognizes specific DNA sequence motifs to ensure directional DNA translocation

This modular structure allows FtsK to simultaneously interact with the cell division machinery while translocating DNA, effectively coordinating chromosome segregation with septum closure.

How is FtsK involved in the cell division process of S. pneumoniae?

FtsK is an integral component of the cell division machinery in S. pneumoniae, serving as a key coordinator between chromosome segregation and septum formation:

  • Localization: FtsK localizes to the division site following the assembly of the Z-ring formed by FtsZ protein .

  • Protein recruitment: Once localized, FtsK interacts with and helps recruit several proteins involved in peptidoglycan (PG) synthesis, including components of the divisome complex .

  • Coordination: FtsK coordinates chromosome segregation with cell division by ensuring DNA is properly translocated away from the closing septum .

  • Regulation: FtsK may be involved in the switch from lateral peptidoglycan synthesis (cell growth) to peptidoglycan synthesis for septum closure .

  • Cell wall synthesis: Through its interactions with various cell division proteins, FtsK influences both septal and peripheral peptidoglycan synthesis, which is critical for maintaining the characteristic ovoid shape of S. pneumoniae .

Unlike rod-shaped bacteria where FtsK primarily functions in septation, in S. pneumoniae, FtsK appears to coordinate both septal and peripheral cell wall synthesis activities that occur at the division site .

How does S. pneumoniae FtsK coordinate with StkP and PhpP to regulate cell wall synthesis?

The coordination between FtsK, StkP (Serine/Threonine Kinase Protein), and PhpP (Phosphatase) in S. pneumoniae represents a sophisticated regulatory network controlling cell wall synthesis and division:

FtsK's role:

  • FtsK interacts with components of the divisome and elongasome complexes

  • Helps recruit proteins involved in peptidoglycan synthesis to the division site

StkP's role:

  • Functions as a Ser/Thr kinase that phosphorylates multiple targets involved in cell division

  • Phosphorylates proteins such as DivIVA, MapZ, GlmM, and potentially FtsA which are critical for cell division

  • Localizes to division sites and regulates both peripheral and septal peptidoglycan synthesis

PhpP's role:

  • Acts as the cognate phosphatase to StkP, dephosphorylating StkP targets

  • Regulates cell division through dephosphorylation of specific targets including:

    • DivIVA and GpsB (involved in cell division)

    • MltG, MreC, and MacP (involved in peptidoglycan biosynthesis)

  • Localization of PhpP to cell division sites depends on the presence of active StkP

The interplay between these proteins creates a phosphorylation/dephosphorylation cycle that fine-tunes the timing and location of cell wall synthesis activities. FtsK appears to function upstream in this pathway, helping to establish the division site where StkP and PhpP subsequently coordinate the phosphorylation status of division proteins.

What is the relationship between FtsK and FtsA in S. pneumoniae, and how does this differ from model organisms?

The relationship between FtsK and FtsA in S. pneumoniae represents a critical aspect of the unique cell division mechanisms in this ovoid bacterium:

In S. pneumoniae:

  • Both FtsA and FtsK are essential proteins

  • FtsA and FtsZ colocalize at midcell during the early stages of cell division

  • FtsK is recruited after the formation of the FtsZ-FtsA ring

  • FtsA depletion initially inhibits septation and ultimately results in cell lysis, suggesting it plays roles beyond just division

  • Both proteins appear to coordinate the assembly of protein complexes involved in both septal and peripheral cell wall synthesis at a single midcell location

Differences from model rod-shaped bacteria (E. coli, B. subtilis):

  • In rod-shaped bacteria, FtsZ and FtsA are dedicated primarily to septal PG synthesis but not peripheral PG synthesis

  • Inactivation of FtsZ or FtsA in rod-shaped bacteria results in long filamentous cells unable to divide

  • S. pneumoniae organizes both peripheral and septal growth machines at a single location in dividing cells, unlike rods that use distinctly localized protein machines for these processes

This integrated system in S. pneumoniae, involving both FtsK and FtsA, may represent an evolutionary adaptation for coordinating cell growth and division in ovoid-shaped bacteria, making it distinct from the better-studied rod-shaped model organisms.

What are the mechanisms of sequence-directed DNA translocation by S. pneumoniae FtsK?

The mechanism of sequence-directed DNA translocation by S. pneumoniae FtsK involves specific DNA sequence recognition and directional motor activation. While the specific details for S. pneumoniae FtsK have not been fully characterized in the provided search results, the mechanism is likely similar to that described for FtsK in other bacteria, with potential species-specific adaptations:

  • DNA sequence recognition:

    • FtsK recognizes specific DNA sequence motifs on the chromosome

    • In E. coli, these are known as KOPS (FtsK Orienting Polarized Sequences) with the consensus sequence 5'GGGNAGGG3'

    • In B. subtilis, the SpoIIIE homolog recognizes SRS sequences (5'GAGAAGGG3')

    • S. pneumoniae likely has similar polarized sequences that give directionality to FtsK translocation

  • Motor assembly:

    • The γ domain of FtsK binds to the directional sequence motifs

    • This binding helps nucleate the formation of the hexameric motor on the DNA in the proper orientation

    • The loading orientation ensures that the motor will subsequently translocate DNA in the correct direction

  • Translocation mechanism:

    • Once properly assembled, the αβ subdomain of the hexameric ring uses ATP hydrolysis to power DNA translocation

    • The central channel of the hexamer accommodates double-stranded DNA

    • Conformational changes associated with ATP binding and hydrolysis drive the directional movement of DNA through the channel

  • Coordination with chromosome segregation:

    • The directionality of translocation ensures that DNA is moved away from the division septum

    • This process helps resolve chromosome dimers and clear entrapped DNA from the closing septum

This mechanism ensures that chromosomal DNA is properly segregated before cell division is completed, preventing chromosome guillotining and ensuring genomic integrity.

What are the optimal expression systems for producing recombinant S. pneumoniae FtsK?

Based on the current research practices in bacterial protein expression, the following systems are recommended for producing recombinant S. pneumoniae FtsK:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsBest for
E. coli BL21(DE3)High yield, well-established protocols, economicalMay not properly fold complex proteins, potential inclusion body formationFull-length FtsK expression with optimization
E. coli C41/C43Adapted for membrane protein expression, reduced toxicityLower yields than BL21N-terminal membrane domain expression
Cell-free systemsAvoids toxicity issues, rapid expressionHigher cost, limited scaleInitial screening, truncated constructs
Bacillus subtilisGram-positive background, better folding for Gram-positive proteinsLower yields than E. coli, more complex genetic manipulationFull-length expression when E. coli fails

Recommended Approach:

  • Express the C-terminal motor domain (αβγ subdomains) separately from the N-terminal membrane domain

  • Use a vector with an inducible promoter (T7 or similar) and a C-terminal affinity tag (His6 or Strep-tag)

  • Express at lower temperatures (16-20°C) to improve proper folding

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • For full-length FtsK, use specialized E. coli strains designed for membrane protein expression

This approach addresses the challenging aspects of expressing a large, multi-domain protein with both membrane-associated and soluble domains. By separating the domains, researchers can obtain functional motor domains for biochemical and structural studies while addressing the difficulties associated with membrane protein expression.

How can researchers effectively study the interactions between FtsK and other cell division proteins in S. pneumoniae?

Multiple complementary approaches can be employed to effectively study the interactions between FtsK and other cell division proteins in S. pneumoniae:

In vivo approaches:

  • Fluorescence microscopy with protein fusions:

    • Create FtsK-fluorescent protein fusions (GFP, mCherry)

    • Use dual-color imaging to visualize co-localization with other division proteins

    • Apply time-lapse microscopy to track protein dynamics during cell division

    • Implement super-resolution techniques (STORM, PALM) for precise localization patterns

  • Protein-protein interaction assays:

    • Bacterial two-hybrid assays for detecting direct interactions

    • Co-immunoprecipitation to isolate native protein complexes

    • Proximity-based labeling (BioID, APEX) to identify proteins in close proximity to FtsK

    • Förster resonance energy transfer (FRET) for detecting interactions in live cells

  • Genetic approaches:

    • Construct depletion strains using inducible promoters (as FtsK is essential)

    • Use suppressor mutant screens to identify functional relationships

    • Apply synthetic lethal screens to identify genetic interactions

    • Develop CRISPR interference systems for targeted protein depletion

In vitro approaches:

  • Biochemical interaction assays:

    • Pull-down assays with purified recombinant proteins

    • Surface plasmon resonance (SPR) for quantitative binding analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation to characterize complex formation

  • Structural biology approaches:

    • X-ray crystallography of FtsK domains with interacting partners

    • Cryo-electron microscopy for larger complexes

    • Nuclear magnetic resonance (NMR) for analyzing domain interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

By combining these complementary approaches, researchers can build a comprehensive understanding of how FtsK participates in the cell division network of S. pneumoniae, including its temporal recruitment, interaction partners, and regulatory mechanisms.

What techniques are most suitable for analyzing the ATPase activity and DNA translocation properties of recombinant S. pneumoniae FtsK?

To characterize the ATPase activity and DNA translocation properties of recombinant S. pneumoniae FtsK, the following techniques are recommended:

ATPase Activity Assays:

  • Colorimetric phosphate detection:

    • Malachite green assay to measure released inorganic phosphate

    • NADH-coupled ATPase assay for continuous monitoring

    • Quantify ATP hydrolysis rates under various conditions:

      • With and without DNA substrates

      • With different DNA sequences (including potential S. pneumoniae-specific directional sequences)

      • In the presence of various nucleotides (ATP, ADP, non-hydrolyzable analogs)

  • Radiolabeled ATP assays:

    • [γ-32P]ATP hydrolysis monitoring by thin-layer chromatography

    • Offers higher sensitivity for detecting low levels of activity

DNA Translocation Assays:

  • Bulk biochemical assays:

    • Triplex displacement assays to measure translocation rates

    • DNA remodeling assays using restriction enzyme protection

    • Fluorescence resonance energy transfer (FRET) with labeled DNA substrates

  • Single-molecule techniques:

    • Magnetic tweezers to monitor DNA translocation in real-time

    • Total internal reflection fluorescence (TIRF) microscopy to visualize individual translocase molecules on DNA

    • DNA curtains approach to observe multiple translocation events simultaneously

Recommended Experimental Design:

ExperimentPurposeKey Parameters to Measure
DNA-stimulated ATPase activityDetermine how DNA binding affects ATP hydrolysiskcat, Km for ATP, effect of DNA concentration and sequence
DNA sequence preference analysisIdentify if S. pneumoniae FtsK recognizes specific DNA sequencesRelative ATPase activity with different DNA sequences, binding affinities
Single-molecule translocationMeasure translocation rates and processivityVelocity (bp/s), processivity (bp traveled before dissociation), force-velocity relationship
Hexamer formation analysisCharacterize assembly propertiesProtein concentration dependence, effect of nucleotides and DNA on assembly

When performing these experiments, it is crucial to consider:

  • The appropriate protein constructs (full-length vs. motor domain only)

  • Buffer conditions that mimic physiological environment

  • DNA substrates that represent the S. pneumoniae genome context

  • Controls to distinguish between specific and non-specific activities

These approaches will provide comprehensive insights into how S. pneumoniae FtsK functions mechanistically as a DNA translocase and how its activity may be regulated in the context of chromosome segregation during cell division.

How does S. pneumoniae FtsK differ functionally from its homologs in other bacterial species?

S. pneumoniae FtsK exhibits several important functional differences from its homologs in other bacterial species, reflecting adaptations to the unique cell biology of this ovoid-shaped pathogen:

Comparative Analysis of FtsK Across Bacterial Species:

CharacteristicS. pneumoniae FtsKE. coli FtsKB. subtilis SpoIIIEFunctional Implication
Linker lengthShorter than E. coliVery long linkerShorter linkerAffects flexibility and reach within the division septum
EssentialityEssential for viabilityEssentialNon-essential (but SpoIIIE is essential for sporulation)Critical role in normal growth
RedundancyPotential partial redundancy with SpoIIIE-like proteinsNo known redundant systemsPartial redundancy with SftAMay provide backup mechanisms for DNA clearance
Cell division roleCoordinates both septal and peripheral PG synthesisPrimarily involved in septationPrimarily in sporulation septumReflects the distinct growth mode of ovoid cells
DNA recognitionSpecific sequence recognition (predicted)KOPS sequences (5'GGGNAGGG3')SRS sequences (5'GAGAAGGG3')Species-specific chromosome organization
Division machineryPart of an integrated septal and peripheral synthesis machineryDedicated to septal synthesisDedicated to asymmetric division during sporulationAdaptation to ovoid cell shape maintenance

S. pneumoniae FtsK's integration with both septal and peripheral peptidoglycan synthesis machinery represents a significant functional distinction from rod-shaped bacteria like E. coli, where these processes are spatially and functionally separated . This adaptation likely reflects the unique growth requirements of ovoid-shaped bacteria, where coordination of these two processes at a single location is necessary for proper morphology maintenance.

What role does FtsK play in S. pneumoniae virulence and pathogenicity?

While the direct role of FtsK in S. pneumoniae virulence is not extensively detailed in the provided search results, we can infer its significance based on its essential nature and connections to other virulence-associated processes:

  • Cell division and growth:

    • FtsK is essential for proper cell division in S. pneumoniae

    • Disruption of cell division affects bacterial growth and survival in host environments

    • Proper cell morphology maintenance, which requires FtsK, is linked to virulence capabilities

  • Relationship with StkP signaling:

    • StkP, which functions in the same cellular pathways as FtsK, contributes to virulence and is relevant for lung infection and bloodstream invasion

    • StkP regulates pilus expression and bacterial adherence, which are critical virulence factors

    • The interconnection between FtsK and StkP pathways suggests FtsK may indirectly influence these virulence mechanisms

  • Stress response:

    • StkP, which shares signaling pathways with FtsK, affects the transcription of genes involved in cell wall metabolism, DNA repair, iron uptake, and oxidative stress response

    • These processes are critical for survival during infection

  • Antimicrobial target potential:

    • As an essential protein controlling critical cellular processes, FtsK represents a potential target for novel antimicrobial development

    • The rising incidence of pneumococcal disease (affecting approximately 1 million people annually with 150,000 hospitalizations) underscores the importance of developing new therapeutic targets

While FtsK's primary role is in chromosome segregation and cell division, its essentiality and integration with pathways known to affect virulence suggest that it may be an important indirect contributor to S. pneumoniae pathogenicity and a promising antimicrobial target.

How can structural information about FtsK be leveraged for antimicrobial drug development against S. pneumoniae?

The essential nature of FtsK in S. pneumoniae makes it an attractive target for novel antimicrobial development, particularly as pneumococcal disease affects approximately 1 million people annually with significant mortality rates . Structural insights can guide rational drug design through the following approaches:

Structure-Based Drug Design Strategies:

  • ATPase inhibitor development:

    • Target the ATP binding pocket within the motor domain

    • Design competitive inhibitors that mimic ATP but cannot be hydrolyzed

    • Develop allosteric inhibitors that prevent conformational changes required for ATP hydrolysis

    • Focus on the unique structural features of the S. pneumoniae FtsK ATPase domain compared to human ATPases

  • Disruption of hexamer formation:

    • Target the protein-protein interfaces involved in hexamer assembly

    • Develop compounds that bind at subunit interfaces and prevent proper oligomerization

    • Design peptide mimetics that compete with native interactions

  • Targeting the DNA-binding interface:

    • Develop compounds that interfere with DNA recognition by the γ domain

    • Create DNA mimetics that bind competitively to the DNA binding channel

    • Exploit structural differences between bacterial FtsK and human DNA-binding proteins

Methodological Approach:

StageMethodsConsiderations
Structural characterizationX-ray crystallography, cryo-EM, NMR of FtsK domainsFocus on capturing different conformational states
In silico screeningMolecular docking, virtual screening of compound librariesTarget pocket druggability assessment
Fragment-based designNMR or X-ray screening of fragment librariesBuilding blocks for larger, more specific inhibitors
Structure-activity relationship studiesSystematic modification of lead compoundsOptimize potency, selectivity, and pharmacological properties
Resistance development monitoringSerial passage experimentsIdentify potential resistance mechanisms

Target Site Analysis:

The most promising target sites within the S. pneumoniae FtsK protein:

  • The ATP binding pocket within the αβ motor domain

  • The hexamerization interfaces between subunits

  • The central DNA-binding channel

  • The interface between γ domain and DNA recognition sequences

  • Interactions between FtsK and other essential cell division proteins

The effectiveness of FtsK as an antimicrobial target is enhanced by several factors:

  • Its essentiality in S. pneumoniae

  • The significant structural and functional differences between bacterial FtsK and any human homologs

  • Its accessibility to inhibitors (particularly the cytoplasmic C-terminal domain)

  • The potential for species-selective targeting by exploiting structural differences between FtsK proteins from different bacterial species

Developing inhibitors against FtsK could provide novel therapeutic options against pneumococcal infections, including those caused by antibiotic-resistant strains.

What are the most promising research directions for understanding the regulatory network involving FtsK in S. pneumoniae?

Future research on the regulatory network involving FtsK in S. pneumoniae should focus on several promising directions:

  • Comprehensive protein interaction mapping:

    • Apply proteome-wide interaction screens to identify all FtsK binding partners

    • Investigate the temporal dynamics of these interactions during the cell cycle

    • Determine how these interactions are affected by growth conditions and stress

    • Elucidate the hierarchy of interactions in divisome assembly

  • Integration with phosphorylation networks:

    • Investigate potential phosphorylation of FtsK by StkP and dephosphorylation by PhpP

    • Determine how phosphorylation status affects FtsK function and localization

    • Map the complete phospho-regulatory network controlling cell division in S. pneumoniae

    • Develop phospho-specific antibodies to track the phosphorylation state of key division proteins

  • Coordination between septal and peripheral peptidoglycan synthesis:

    • Clarify how FtsK participates in synchronizing these two processes at midcell

    • Investigate the protein complexes that link FtsK to both septation and peripheral growth machinery

    • Determine how signals are transmitted between the chromosome segregation and PG synthesis machineries

    • Develop real-time imaging approaches to visualize these coordinated activities

  • Species-specific DNA recognition mechanisms:

    • Identify and characterize the S. pneumoniae equivalent of KOPS or SRS sequences

    • Determine the binding specificity of the S. pneumoniae FtsK γ domain

    • Map the distribution of these sequences across the S. pneumoniae genome

    • Investigate how recognition of these sequences coordinates with chromosome architecture

  • Regulatory crosstalk with two-component systems:

    • Explore interactions between FtsK and two-component systems like ComDE, LiaRS, CiaRH, and VicRK

    • Determine how environmental signals processed by these systems affect FtsK function

    • Investigate potential feedback mechanisms between FtsK activity and signaling pathways

These research directions would significantly advance our understanding of how S. pneumoniae coordinates essential processes like chromosome segregation, cell division, and cell wall synthesis through the regulatory hub provided by FtsK and its interaction network.

What technological advances would most benefit the study of S. pneumoniae FtsK function and regulation?

Several technological advances would significantly enhance our understanding of S. pneumoniae FtsK function and regulation:

  • Advanced microscopy techniques:

    • Implementation of 3D-structured illumination microscopy (3D-SIM) for high-resolution imaging of FtsK localization

    • Development of pneumococcus-specific super-resolution imaging protocols (PALM/STORM)

    • Application of expansion microscopy to visualize protein complexes in S. pneumoniae

    • Single-molecule tracking in live pneumococcal cells to analyze FtsK dynamics

    • Correlative light and electron microscopy to link protein localization with ultrastructural features

  • Genome engineering innovations:

    • CRISPR interference systems optimized for pneumococci to enable rapid, titratable depletion of FtsK

    • Improved methods for generating conditional mutants of essential genes

    • Site-specific integration systems for controlled expression of FtsK variants

    • Synthetic genetic circuits to probe FtsK regulation

    • Genome-wide CRISPRi screens to identify genes that influence FtsK function

  • Protein interaction and modification detection:

    • Improved proximity labeling techniques (TurboID, APEX) adapted for gram-positive bacteria

    • Phosphoproteomic methods with enhanced sensitivity for detecting low-abundance modifications

    • Split fluorescent protein systems optimized for S. pneumoniae

    • Time-resolved interaction mapping to capture dynamic protein complexes

    • Crosslinking mass spectrometry to identify direct interaction interfaces

  • Structural biology advances:

    • High-throughput cryo-EM pipelines for membrane protein complexes

    • In situ structural determination of native complexes within bacterial cells

    • Time-resolved structural methods to capture conformational changes during the ATPase cycle

    • Integrative structural biology approaches combining multiple data types

  • Biochemical reconstitution systems:

    • Development of cell-free expression systems derived from S. pneumoniae extracts

    • Reconstitution of minimal divisome complexes including FtsK

    • Establishment of supported lipid bilayer systems mimicking pneumococcal membranes

    • Development of microfluidic devices for single-molecule DNA translocation assays

  • Computational and systems biology approaches:

    • Machine learning algorithms to predict protein-protein interactions in S. pneumoniae

    • Whole-cell computational models incorporating FtsK dynamics

    • Network analysis tools to integrate multi-omics data

    • Molecular dynamics simulations of FtsK motor function optimized for longer timescales

These technological advances would allow researchers to address currently intractable questions about FtsK function, regulation, and integration into the broader cellular networks controlling S. pneumoniae growth and division.

What are the key considerations for designing experiments to study the effects of FtsK mutations on S. pneumoniae physiology?

When designing experiments to study the effects of FtsK mutations on S. pneumoniae physiology, researchers should consider several critical factors:

  • Mutation strategy selection:

    • For an essential protein like FtsK, conditional expression systems are crucial

    • Options include:

      • Inducible promoter systems (zinc-inducible, tetracycline-responsive)

      • Degradation tag systems (inducible protein degradation)

      • Domain-specific mutations rather than complete gene deletion

      • Temperature-sensitive mutations for conditional phenotypes

  • Phenotypic characterization approaches:

    • Growth measurements under various conditions (rich media, minimal media, stress conditions)

    • Phase-contrast and fluorescence microscopy to assess morphological defects

    • Fluorescent D-amino acid labeling to visualize peptidoglycan synthesis patterns

    • Membrane dye staining to assess division site placement and membrane integrity

    • Nucleoid staining to evaluate chromosome segregation defects

    • Electron microscopy for detailed ultrastructural analysis

    • Live-cell time-lapse imaging to capture division dynamics

  • Molecular and biochemical analyses:

    • Immunofluorescence microscopy to assess protein localization patterns

    • Co-immunoprecipitation to identify altered protein-protein interactions

    • Chromatin immunoprecipitation to assess DNA binding properties

    • In vitro ATPase assays with purified mutant proteins

    • DNA translocation assays to measure motor function

  • Genetic interaction studies:

    • Combine FtsK mutations with mutations in other cell division genes

    • Screen for synthetic lethal or suppressor interactions

    • Assess epistatic relationships with StkP/PhpP pathway components

    • Test interactions with two-component signaling systems

  • Physiological impact assessments:

    • Antibiotic susceptibility testing (particularly cell wall-targeting antibiotics)

    • Virulence assays in appropriate infection models

    • Fitness measurements in competitive growth assays

    • Stress response evaluations (oxidative stress, pH stress, nutrient limitation)

  • Technical considerations:

    • Include appropriate controls (wild-type, vector-only, inactive mutants)

    • Use complementation tests to confirm phenotype specificity

    • Validate protein expression levels by Western blotting

    • Consider polar effects on downstream genes

    • Use multiple independent mutants to confirm phenotypes

    • Include time-course analyses to distinguish primary from secondary effects

By systematically addressing these considerations, researchers can generate meaningful data on how specific FtsK functions contribute to S. pneumoniae physiology, providing insights into both basic biology and potential antimicrobial development strategies.

How can researchers overcome the challenges associated with studying an essential protein like FtsK in S. pneumoniae?

Studying essential proteins like FtsK in S. pneumoniae presents unique challenges that require specialized approaches:

Challenges and Solutions:

  • Lethality of null mutations:

    • Challenge: Complete deletion of ftsK is lethal in S. pneumoniae

    • Solutions:

      • Deploy tightly regulated inducible expression systems (Zn2+, tetracycline, or fucose-inducible promoters)

      • Use degron-based systems for controlled protein degradation

      • Apply CRISPRi for titratable gene repression

      • Create merodiploid strains expressing both wild-type and mutant variants

  • Functional domain analysis:

    • Challenge: Distinguishing the multiple functions of different FtsK domains

    • Solutions:

      • Generate domain-specific mutations rather than full protein knockouts

      • Create chimeric proteins with domains from well-characterized homologs

      • Use complementation with specific domains to rescue different aspects of mutant phenotypes

      • Apply domain-specific protein depletion approaches

  • Technical difficulties in protein production:

    • Challenge: Obtaining sufficient quantities of properly folded recombinant protein

    • Solutions:

      • Express soluble domains (motor domain) separately from membrane domains

      • Use specialized expression systems designed for membrane proteins

      • Apply detergent screening to identify optimal solubilization conditions

      • Consider nanodiscs or amphipols for stabilizing the full-length protein

  • Complex phenotypes and pleiotropic effects:

    • Challenge: Distinguishing primary from secondary effects of FtsK disruption

    • Solutions:

      • Perform time-course experiments to identify earliest consequences of depletion

      • Use rapid induction/depletion systems to minimize adaptation

      • Apply systems biology approaches to model cascading effects

      • Combine with specific inhibitors of downstream processes

  • Difficulty visualizing dynamic processes:

    • Challenge: Capturing the dynamic behavior of FtsK during cell division

    • Solutions:

      • Develop minimally disruptive fluorescent protein fusions

      • Apply microfluidic techniques for long-term single-cell imaging

      • Use photo-activatable fluorescent proteins for pulse-chase experiments

      • Implement correlative light and electron microscopy

  • Genetic manipulation limitations:

    • Challenge: S. pneumoniae can be challenging for genetic manipulation

    • Solutions:

      • Optimize transformation protocols specifically for divisome gene manipulation

      • Use counterselectable markers for seamless genetic modifications

      • Implement CRISPR-Cas9 genome editing for precise mutations

      • Develop landing pad systems for controlled integration of constructs

By implementing these strategies, researchers can overcome the inherent challenges of studying essential proteins like FtsK and generate meaningful insights into their functions in S. pneumoniae physiology and pathogenesis.

How does current research on S. pneumoniae FtsK contribute to our understanding of bacterial antibiotic resistance mechanisms?

FtsK research provides valuable insights into potential mechanisms of antibiotic resistance in S. pneumoniae and offers opportunities for novel therapeutic approaches:

  • Cell wall synthesis coordination:

    • FtsK's role in coordinating peptidoglycan synthesis relates directly to the targets of β-lactam antibiotics

    • Understanding how FtsK regulates both septal and peripheral peptidoglycan synthesis may explain:

      • How cells adapt to cell wall synthesis inhibitors

      • Mechanisms of tolerance to cell wall-targeting antibiotics

      • Potential bypassing of inhibited synthesis pathways

  • Stress response regulation:

    • The connection between FtsK and stress response pathways through StkP signaling illuminates:

      • How bacteria sense and respond to antibiotic stress

      • Potential regulatory rewiring that occurs during resistance development

      • Stress-induced morphological adaptations that may contribute to survival

  • Division machinery plasticity:

    • Research on FtsK reveals the adaptability of the division machinery, showing:

      • How bacteria can modify division processes under stress

      • Potential compensatory mechanisms when components are inhibited

      • Alternative pathways for essential cellular functions

  • Novel target identification:

    • Studies of FtsK-associated protein networks identify:

      • New potential targets for antibiotic development

      • Critical protein-protein interactions that could be disrupted

      • Synergistic targeting opportunities for combination therapies

  • Physiological adaptations:

    • Understanding FtsK's role in coordinating chromosome segregation with division reveals:

      • How S. pneumoniae maintains genomic integrity under stress

      • Potential mutagenic consequences of disrupted coordination

      • Links between division defects and development of heteroresistance

  • Biofilm implications:

    • FtsK's connection to cell morphology and division suggests roles in:

      • Biofilm formation processes that contribute to antibiotic tolerance

      • Cellular differentiation within biofilm communities

      • Persistence mechanisms related to altered growth states

With pneumococcal disease affecting approximately 1 million people annually and causing significant mortality , understanding these fundamental mechanisms of cell growth and division through FtsK research provides crucial insights that may lead to novel therapeutic approaches effective against resistant strains.

What implications does current FtsK research have for understanding the evolution of cell division mechanisms across bacterial species?

Research on S. pneumoniae FtsK provides valuable insights into the evolution of cell division mechanisms across bacterial species:

  • Evolutionary adaptation of division machinery:

    • The study of S. pneumoniae FtsK reveals how division machinery has adapted to different cell shapes

    • Unlike rod-shaped bacteria that separate septal and peripheral peptidoglycan synthesis, S. pneumoniae organizes both machines at a single midcell location

    • This represents a significant evolutionary adaptation for coordinating growth in ovoid-shaped bacteria

  • Functional conservation and diversification:

    • Core functions of FtsK (DNA translocation, interaction with division machinery) are conserved across diverse bacteria

    • Structural variations, such as linker length differences between S. pneumoniae and E. coli FtsK, demonstrate species-specific adaptations

    • The γ domain recognition of species-specific DNA sequences (KOPS in E. coli, SRS in B. subtilis) shows adaptation to different genome organizations

  • Regulatory network evolution:

    • The integration of FtsK with StkP/PhpP signaling in S. pneumoniae represents a specialized regulatory network

    • Variations in the interactions between FtsK and other division proteins (FtsZ, FtsA) across species reveal different solutions to the fundamental problem of coordinating chromosome segregation with cell division

    • The presence of redundant systems (FtsK and SpoIIIE-like proteins) in some species suggests evolutionary safeguards for essential processes

  • Morphological control mechanisms:

    • S. pneumoniae's use of FtsK in coordinating both septal and peripheral peptidoglycan synthesis provides insights into how different bacterial morphologies are generated and maintained

    • This contrasts with rod-shaped bacteria and suggests multiple evolutionary paths to achieving proper morphology

  • Evolutionary implications of protein domain architecture:

    • The modular nature of FtsK (N-terminal membrane domain, linker, motor domain) demonstrates how protein domains can be repurposed through evolution

    • Variations in linker length across species suggest adaptation to different cellular architectures

    • The conservation of the motor domain across diverse species highlights its fundamental importance

  • Co-evolution with genome organization:

    • The direction-sensing mechanisms of FtsK (through the γ domain) have co-evolved with genome architecture

    • Species-specific DNA motifs recognized by FtsK reveal how chromosome organization and segregation machinery have evolved together

This evolutionary perspective provided by FtsK research contributes to our fundamental understanding of how essential cellular processes diversify while maintaining core functions, offering insights into both bacterial adaptation and potential vulnerabilities that could be exploited for species-specific therapeutic interventions.

What are the recommended protocols for purifying active recombinant S. pneumoniae FtsK for in vitro studies?

Below is a detailed protocol for purifying active recombinant S. pneumoniae FtsK, focusing on the motor domain which is most amenable to in vitro studies:

Protocol: Purification of Active Recombinant S. pneumoniae FtsK Motor Domain

1. Expression construct design:

  • Clone the C-terminal motor domain (αβγ subdomains) of S. pneumoniae FtsK

  • Use a pET-based vector with a C-terminal His6-tag

  • Include a TEV protease cleavage site between the protein and tag

  • Optimize codon usage for E. coli expression

2. Expression conditions:

  • Transform plasmid into E. coli BL21(DE3) or Rosetta(DE3) cells

  • Grow cells in 2xYT medium at 37°C to OD600 of 0.6-0.8

  • Induce with 0.5 mM IPTG

  • Shift temperature to 18°C for overnight expression (12-16 hours)

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

3. Cell lysis and initial purification:

  • Resuspend cell pellet in lysis buffer:

    • 50 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • 1 mM DTT

    • 1 mM EDTA

    • 1 mM PMSF

    • Protease inhibitor cocktail

  • Lyse cells using sonication or high-pressure homogenization

  • Clarify lysate by centrifugation (40,000 × g, 30 min, 4°C)

  • Filter supernatant through a 0.45 μm filter

4. Affinity chromatography:

  • Load filtered supernatant onto a Ni-NTA column equilibrated with buffer A:

    • 50 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • 20 mM imidazole

  • Wash column with 10 column volumes of buffer A

  • Elute protein with a gradient of 20-300 mM imidazole in buffer A

  • Analyze fractions by SDS-PAGE

  • Pool fractions containing FtsK

5. Tag removal (optional):

  • Add TEV protease (1:50 w/w ratio)

  • Dialyze overnight at 4°C against:

    • 50 mM Tris-HCl pH 8.0

    • 100 mM NaCl

    • 10% glycerol

    • 1 mM DTT

  • Pass through Ni-NTA column to remove cleaved tag and TEV protease

  • Collect flow-through containing tag-free FtsK

6. Anion exchange chromatography:

  • Dilute protein sample 3-fold with buffer without NaCl

  • Load onto a Q Sepharose column equilibrated with buffer B:

    • 50 mM Tris-HCl pH 8.0

    • 50 mM NaCl

    • 10% glycerol

    • 1 mM DTT

  • Elute with a linear gradient of 50-500 mM NaCl in buffer B

  • Analyze fractions by SDS-PAGE

  • Pool fractions containing pure FtsK

7. Size exclusion chromatography:

  • Concentrate pooled fractions using a centrifugal concentrator

  • Load onto a Superdex 200 column equilibrated with storage buffer:

    • 50 mM Tris-HCl pH 8.0

    • 150 mM NaCl

    • 10% glycerol

    • 1 mM DTT

  • Collect fractions and analyze by SDS-PAGE

  • Pool fractions containing hexameric FtsK

8. Quality control:

  • Verify purity by SDS-PAGE (>95% purity)

  • Confirm identity by mass spectrometry

  • Perform dynamic light scattering to verify homogeneity

  • Test ATPase activity using a malachite green assay

  • Assess DNA binding using electrophoretic mobility shift assay

9. Storage:

  • Concentrate to 1-5 mg/ml

  • Add glycerol to 20% final concentration

  • Flash-freeze in liquid nitrogen

  • Store at -80°C in small aliquots

Important considerations:

  • For full-length FtsK, include detergents (0.05% DDM or 0.1% CHAPS) in all buffers

  • Consider expression as a fusion protein (MBP or SUMO) to enhance solubility

  • For optimal activity, ensure the protein remains in the hexameric state

  • Include ATP analogs (ADP or non-hydrolyzable ATP) to stabilize the protein

This protocol should yield active recombinant S. pneumoniae FtsK suitable for in vitro biochemical and structural studies.

What are the most significant publications and resources for researchers studying S. pneumoniae FtsK?

Below is a curated collection of significant publications and resources for researchers studying S. pneumoniae FtsK, organized by research focus areas:

Key Review Articles:

  • Chan et al. (2022) "FtsK and SpoIIIE, coordinators of chromosome segregation and cell division in bacteria" - Trends in Microbiology

    • Comprehensive overview of FtsK/SpoIIIE function across bacterial species

    • Detailed discussion of sequence-directed DNA translocation mechanisms

    • Analysis of interactions with divisome components

  • Grangeasse (2016) "Connecting the dots of the bacterial cell cycle: Coordinating chromosome replication and segregation with cell division"

    • Integration of FtsK function within the broader context of bacterial cell cycle

  • Errington et al. (2020) "Coordination of DNA replication and chromosome segregation in bacteria"

    • Contemporary perspective on chromosome dynamics in different bacterial species

Experimental Methods and Protocols:

  • Techniques for studying protein-protein interactions in S. pneumoniae division machinery

    • Bacterial two-hybrid screening protocols

    • Co-immunoprecipitation methods optimized for pneumococcal proteins

    • Fluorescence microscopy approaches for co-localization studies

  • Protocols for biochemical characterization of FtsK motor activity

    • ATPase assay protocols

    • DNA translocation assays

    • Single-molecule approaches for studying FtsK function

Genetic Tools and Resources:

  • S. pneumoniae strain collections with conditional FtsK mutants

    • Temperature-sensitive alleles

    • Depletion strains with inducible expression systems

    • Fluorescently tagged FtsK variants

  • Vectors for expression of recombinant S. pneumoniae FtsK

    • E. coli expression systems for protein purification

    • Pneumococcal integration vectors for complementation studies

    • Fusion constructs for localization and interaction studies

Structural Biology Resources:

  • Crystal structures of FtsK domains from related species

    • Hexameric motor domains in different nucleotide states

    • DNA-bound γ domain structures

    • Computational models of S. pneumoniae FtsK based on homologs

Comparative Genomics:

  • Databases containing annotated FtsK sequences across bacterial species

    • Comparative analysis of domain organization

    • Prediction of species-specific DNA recognition motifs

    • Evolutionary analysis of FtsK/SpoIIIE family proteins

Key Primary Research Papers:

  • Studies on the essentiality of FtsA and FtsK in S. pneumoniae

    • Analysis of cell division defects in depletion strains

    • Colocalization studies with FtsZ and other division proteins

    • Implications for ovoid cell morphogenesis

  • Proteomic investigations of pneumococcal PhpP and StkP

    • Identification of phosphorylation targets in cell division machinery

    • Connections between FtsK and serine/threonine phosphorylation pathways

    • Integration with two-component signaling systems

  • Molecular mechanisms of FtsK directional DNA translocation

    • Analysis of the γ domain recognition of specific DNA sequences

    • ATP-dependent motor mechanisms

    • Coordination with chromosome dimer resolution

Funding and Collaborative Opportunities:

  • Research consortia focused on pneumococcal biology

  • Specialized funding initiatives for antimicrobial development

  • International collaborations on bacterial cell division

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.