Recombinant Streptococcus pneumoniae Glycerol uptake facilitator protein (glpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery timelines may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpF; spr1988; Glycerol uptake facilitator protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
glpF
Target Protein Sequence
MMNELFGEFLGTLILILLGNGVVAGVVLPKTKSNSSGWIVITMGWGIAVAVAVFVSGKLSPAHLNPAVTIGVALKGGLPWASVLPYILAQFAGAMLGQILVWLQFKPHYEAEENAGNILATFSTGPAIKDTVSNLISEILGTFVLVLTIFALGLYDFQAGIGTFAVGTLIVGIGLSLGGTTGYALNPARDLGPRIMHSILPIPNKGDGDWSYAWIPVVGPVIGAALAVLVFSLF
Uniprot No.

Target Background

Function
Glycerol enters the cell through the glycerol diffusion facilitator protein. This membrane protein facilitates the passage of glycerol across the cytoplasmic membrane.
Database Links

KEGG: spr:spr1988

STRING: 171101.spr1988

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of glpF in Streptococcus pneumoniae metabolism?

The glycerol uptake facilitator protein (glpF) in S. pneumoniae is part of the glycerol metabolism pathway, facilitating the uptake of glycerol via facilitated diffusion across the cell membrane . As part of the aquaglyceroporin family, glpF forms a membrane channel protein that is selective for the transport of glycerol . In the pneumococcal metabolic network, glycerol metabolism involves uptake by the glpF facilitator, followed by phosphorylation by glycerol kinase (glpK), and subsequent oxidation of glycerol 3-phosphate to dihydroxyacetone phosphate, which enters glycolysis .

How does S. pneumoniae glpF differ structurally from other bacterial glycerol facilitators?

While sharing similarities with other bacterial glycerol facilitators, S. pneumoniae glpF contains unique structural elements. Unlike E. coli GlpF, which has been extensively characterized, the pneumococcal glpF is distinguished by the presence of repetitive intergenic elements known as boxes A and C following the gene . These stem-loop-forming elements influence the frequency of phase variation in colony opacity, suggesting a regulatory role beyond simple glycerol transport . At the protein level, the oligomeric state of GlpF can vary depending on environmental conditions, with factors such as ionic strength and Mg²⁺ concentration affecting its assembly into tetramers .

Is glpF essential for S. pneumoniae viability?

Based on comparative studies with other bacteria, glpF appears to be essential for S. pneumoniae. In Mycoplasma pneumoniae, attempts to isolate mutants affected in genes of glycerol metabolism revealed that glpF, encoding the glycerol facilitator, is essential . This essentiality suggests that glpF serves critical functions beyond glycerol metabolism, potentially involving cell membrane integrity or other metabolic pathways. Researchers should consider this essentiality when designing knockout experiments or targeting glpF for antimicrobial development.

What are the recommended methods for expressing and purifying recombinant S. pneumoniae glpF?

For effective expression and purification of recombinant S. pneumoniae glpF, a multi-step approach is recommended:

  • Expression system selection: A bicistronic construct encoding both histidine-tagged (His-glpF) and hemagglutinin-tagged (HA-glpF) can be designed for bacterial expression .

  • Purification protocol:

    • Solubilize membrane preparations in detergent (octyl glucoside is commonly used)

    • Perform Ni-nitrilotriacetate affinity purification for His-tagged proteins

    • Consider ionic strength conditions during purification, as low ionic strength favors subunit dissociation

    • Add Mg²⁺ to stabilize tetrameric assembly during purification

  • Verification of oligomeric state: Conduct sucrose gradient sedimentation analysis to determine the oligomeric state of the purified protein .

The protocol must be optimized based on research objectives, particularly considering that the stability of the protein's oligomeric state is influenced by buffer conditions.

How can functional activity of recombinant S. pneumoniae glpF be assessed in vitro?

Functional assessment of recombinant glpF can be performed through reconstitution into proteoliposomes and subsequent permeability assays:

  • Proteoliposome preparation:

    • Incorporate purified glpF into phospholipid vesicles

    • Control protein-to-lipid ratio to ensure proper insertion

  • Permeability assays:

    • Glycerol permeability: Measure the rate of glycerol transport across the proteoliposome membrane. Properly reconstituted GlpF can increase glycerol permeability more than 100-fold compared to control liposomes .

    • Water permeability: Although primarily a glycerol facilitator, glpF also transports water. Reconstitution can increase water permeability up to 10-fold .

  • Inhibition studies: Test the effect of potential inhibitors on transport activity to identify compounds that could serve as research tools or therapeutic leads.

ParameterControl LiposomesGlpF-Reconstituted LiposomesFold Increase
Glycerol PermeabilityBaseline>100× Baseline>100
Water PermeabilityBaselineUp to 10× BaselineUp to 10

What methods are effective for studying the expression regulation of S. pneumoniae glpF?

To investigate the regulation of glpF expression in S. pneumoniae, researchers can employ several complementary approaches:

  • Reporter gene assays: Fuse the glpF promoter region to a reporter gene (e.g., luciferase) to monitor promoter activity under different conditions.

  • RT-qPCR analysis: Quantify glpF mRNA levels to assess transcriptional responses to environmental stimuli.

  • Box element manipulation: Since box elements (A and C) following the glpF gene influence expression frequency, targeted mutagenesis of these elements can reveal their regulatory mechanisms .

  • Transformation experiments: Introduce different regulatory elements through transformation to identify factors affecting expression levels and phase variation frequency .

  • Colony opacity assessment: Monitor changes in colony opacity as a phenotypic marker for variations in glpF expression, as colony opacity has been linked to glpF function and regulation .

How does glpF contribute to S. pneumoniae virulence and colonization?

The contribution of glpF to S. pneumoniae virulence appears to be multifaceted:

  • Nasopharyngeal colonization: Differences in colony opacity, which are influenced by glpF and associated regulatory elements, correlate with differences in the ability of organisms to colonize the mucosal surface of the nasopharynx in animal models .

  • Phase variation: The glpF locus, along with its regulatory elements, participates in phase variation of colony morphology, which is crucial for adaptation to different host environments during infection .

  • Metabolic adaptation: By facilitating glycerol uptake, glpF likely supports pneumococcal metabolism in host environments where glycerol is available, potentially including blood and lung tissue.

  • Cell wall integrity: The association between glpF, colony opacity, and cell wall autolysis suggests a role in modulating cell wall properties that could affect immune recognition and antibiotic susceptibility .

What is the relationship between glpF function and pneumococcal immune evasion?

While direct evidence linking glpF to immune evasion is limited, several indirect connections can be inferred:

  • Phase variation: The opacity variation influenced by the glpF locus may help S. pneumoniae evade host immune responses by altering surface properties and antigen presentation .

  • Colonization persistence: The ability to modulate colonization characteristics through glpF-related mechanisms likely contributes to persistent nasopharyngeal carriage despite host immune pressure.

  • Adaptation to immune environments: By facilitating metabolic adaptation through glycerol utilization, glpF may support pneumococcal survival in immune-restricted environments.

Research suggests that exploring the immunomodulatory effects of glpF could reveal new insights into pneumococcal pathogenesis and potential therapeutic targets.

How conserved is glpF across Streptococcus pneumoniae strains and other Streptococcus species?

The conservation of glpF across S. pneumoniae strains and related species provides insights into its evolutionary importance:

How does the structure-function relationship of S. pneumoniae glpF compare to E. coli GlpF and other aquaglyceroporins?

Comparative analysis reveals important structural and functional similarities and differences:

  • Channel architecture: Both S. pneumoniae glpF and E. coli GlpF belong to the aquaglyceroporin family, forming membrane channels selective for glycerol transport . The core structure likely consists of six transmembrane domains with intracellular N- and C-termini.

  • Oligomerization properties: E. coli GlpF forms tetramers, stabilized by Mg²⁺ and affected by ionic conditions . S. pneumoniae glpF likely shares similar oligomerization properties, though species-specific differences may exist.

  • Substrate selectivity: While primarily glycerol facilitators, these proteins also transport water at different rates . The selectivity filter residues that determine this dual functionality are likely conserved.

  • Regulatory mechanisms: Unlike E. coli GlpF, S. pneumoniae glpF is associated with distinctive regulatory elements (boxes A and C) that influence expression patterns and colony phenotypes , representing a species-specific adaptation.

What are potential approaches for developing inhibitors targeting S. pneumoniae glpF?

The development of selective inhibitors targeting S. pneumoniae glpF represents a promising research direction:

  • Structure-based design: Using homology models based on related aquaglyceroporins, researchers can identify potential binding sites for small molecule inhibitors.

  • High-throughput screening: Functional assays using reconstituted glpF in proteoliposomes can be adapted for screening compound libraries to identify inhibitors of glycerol transport .

  • Allosteric targeting: Rather than targeting the channel pore directly, inhibitors could be designed to disrupt tetrameric assembly or alter the conformation of the protein.

  • Regulatory element targeting: Given the importance of regulatory elements in glpF function, molecules that interact with box elements or associated regulatory proteins could indirectly modulate glpF activity .

  • Selectivity considerations: Ideal inhibitors would selectively target pneumococcal glpF without affecting human aquaporins or commensal bacterial transporters.

What experimental models are most appropriate for studying the impact of glpF mutations on S. pneumoniae pathogenesis?

Several experimental models can be employed to study the impact of glpF mutations:

  • In vitro colonization models:

    • Human respiratory epithelial cell lines to assess adherence and invasion

    • Biofilm formation assays to evaluate the role of glpF in community behavior

  • Animal models:

    • Mouse nasopharyngeal colonization model to study the relationship between glpF, colony opacity, and mucosal colonization

    • Pneumonia models to assess lung invasion and survival rates, similar to those used in rPgdA studies

    • Sepsis models for systemic infection studies

  • Conditional expression systems:

    • Since glpF appears to be essential in some contexts , conditional expression systems are necessary to study its function without complete gene deletion

  • Humanized mouse models:

    • For studying host-specific aspects of glpF-mediated colonization and pathogenesis

How might S. pneumoniae glpF function be exploited for novel vaccine development strategies?

Building on lessons from other pneumococcal protein-based vaccine approaches:

  • Protein-based vaccine: Recombinant glpF could be evaluated as a vaccine antigen, similar to studies with PgdA protein .

  • Strategic considerations:

    • Like rPgdA, a glpF-based vaccine might reduce lung invasion without affecting nasopharyngeal colonization

    • This approach could potentially prevent invasive disease while maintaining beneficial nasopharyngeal microbiota

  • Combination approaches:

    • glpF could be combined with other pneumococcal proteins for broader protection

    • As suggested for rPgdA, combination with other proteins may provide better prevention of pneumococcal infection

  • Serotype-independent protection:

    • Unlike polysaccharide-based vaccines that target specific serotypes, protein-based vaccines using conserved proteins like glpF could potentially provide broad protection against diverse pneumococcal strains

    • This approach might avoid the serotype replacement issues seen with current pneumococcal conjugate vaccines

What strategies can address poor expression or instability of recombinant S. pneumoniae glpF?

Researchers encountering expression or stability issues with recombinant glpF should consider:

  • Expression system optimization:

    • Try different promoters, host strains, and induction conditions

    • Consider membrane protein expression specialists like C41(DE3) or C43(DE3) E. coli strains

    • Evaluate co-expression with chaperones to improve folding

  • Stabilization approaches:

    • Include Mg²⁺ in buffers to stabilize tetrameric assembly

    • Optimize ionic strength conditions, as low ionic strength favors subunit dissociation

    • Test different detergents beyond octyl glucoside for improved stability

  • Fusion protein strategies:

    • N- or C-terminal fusions with stabilizing partners

    • Dual-tagging approaches (His-tag and HA-tag) to facilitate detection and purification

  • Storage considerations:

    • Determine optimal temperature, buffer composition, and additives for long-term storage

    • Consider flash-freezing aliquots in the presence of glycerol as a cryoprotectant

How can researchers differentiate between phenotypes caused by glpF dysfunction versus other glycerol metabolism genes?

Distinguishing the specific contribution of glpF from other glycerol metabolism genes requires careful experimental design:

  • Genetic complementation:

    • Introduce wild-type glpF on a plasmid to verify phenotype rescue

    • Use site-directed mutagenesis to create channel-dead versions that maintain structural integrity

  • Metabolic bypass experiments:

    • Provide metabolic intermediates downstream of glycerol uptake to bypass glpF-dependent steps

    • Compare phenotypes with mutations in glpD or glpK genes

  • Functional assays:

    • Directly measure glycerol uptake to confirm transport defects

    • Assess hydrogen peroxide production, which in some bacteria depends on glpD function downstream of glpF

  • Colony opacity analysis:

    • Monitor changes in colony opacity as a specific phenotypic marker linked to glpF function

    • Compare with opacity changes caused by mutations in other glycerol metabolism genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.