Recombinant Streptococcus pneumoniae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks, and we will prepare the product accordingly.
Lead Time
The delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; spr0829; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
lspA
Target Protein Sequence
MKKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSWIPNFVSLTYLQNRGAAFSILQDQ QLLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDRVSQGFVVDMFHLD FINFAIFNVADSYLTVGVIILLIAMLKEEINGN
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: spr:spr0829

STRING: 171101.spr0829

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its role in Streptococcus pneumoniae?

Lipoprotein signal peptidase (LspA) is a transmembrane type II signal peptidase that plays a crucial role in the maturation of bacterial lipoproteins in S. pneumoniae . It functions by cleaving the signal peptide from prolipoprotein precursors after lipid modification, which is essential for the proper localization and function of mature lipoproteins. LspA is part of the lipoprotein processing pathway that includes lipoprotein diacylglyceryl transferase (Lgt) and lipoprotein N-acyl transferase (Lnt) in many bacteria.

The proper processing of lipoproteins is vital for S. pneumoniae pathogenesis as these surface proteins are involved in multiple functions including nutrient acquisition, adhesion, invasion, and evasion of host immune responses. Recent research has demonstrated that LspA deficiency results in reduced lipoprotein expression and significantly impacts the bacterial interaction with host immune cells .

How does LspA deficiency affect S. pneumoniae virulence and host immune response?

LspA deficiency in S. pneumoniae has been shown to alter the bacterium's interaction with the host immune system in several important ways:

These findings suggest that LspA plays an important role in the immunostimulatory properties of S. pneumoniae, likely through its function in processing lipoproteins that are recognized by pattern recognition receptors such as Toll-like receptor 2 (TLR2).

How does S. pneumoniae LspA compare with other bacterial lipoprotein processing enzymes?

While the search results don't provide direct comparative data, general principles can be established based on research on bacterial lipoprotein processing machinery. S. pneumoniae LspA likely shares the core catalytic mechanism with other bacterial type II signal peptidases, but may have specific structural features adapted to the unique lipoproteins of S. pneumoniae.

Unlike some Gram-negative bacteria where lipoprotein processing involves a three-enzyme system (Lgt, LspA, and Lnt), many Gram-positive bacteria, including pneumococci, may rely primarily on Lgt and LspA. The specific substrate recognition and processing efficiency of pneumococcal LspA may be tailored to the particular composition of pneumococcal lipoproteins, which include important virulence factors.

What experimental approaches are most effective for generating and characterizing recombinant S. pneumoniae LspA?

The generation and characterization of recombinant S. pneumoniae LspA requires specialized approaches due to its nature as a membrane protein. Based on research methodologies for similar proteins, the following protocol would be effective:

Expression System Selection:

  • E. coli expression systems with specialized vectors containing tags (His, GST) for membrane protein expression

  • Cell-free expression systems for difficult-to-express membrane proteins

  • Baculovirus-insect cell expression for complex eukaryotic studies

Purification Strategy:

  • Detergent solubilization (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography for final polishing

Functional Characterization:

  • In vitro enzymatic assays using synthetic peptide substrates

  • Mass spectrometry to confirm cleavage sites

  • Circular dichroism for secondary structure analysis

  • Thermal shift assays for stability assessment

The successful generation of LspA-deficient strains, as reported in recent research, suggests that precise genetic manipulation techniques like homologous recombination or CRISPR-Cas9 can be effectively applied to study this protein in its native context .

How can researchers effectively analyze the impact of LspA on the pneumococcal lipoproteome?

To comprehensively analyze the impact of LspA on the S. pneumoniae lipoproteome, researchers should employ a multi-faceted approach:

Comparative Proteomics Workflow:

  • Sample Preparation:

    • Culture wild-type and isogenic LspA-deficient strains under identical conditions

    • Fractionate cells to isolate membrane and associated proteins

    • Perform Triton X-114 phase separation to enrich for lipoproteins

  • Analytical Techniques:

    • LC-MS/MS shotgun proteomics for broad lipoproteome identification

    • SILAC or TMT labeling for quantitative comparisons

    • Targeted MRM assays for specific lipoproteins of interest

  • Bioinformatic Analysis:

    • Prediction of lipoproteins using algorithms like LipoP

    • Pathway enrichment analysis to identify affected functional categories

    • Structural modeling of processing sites

  • Validation Methods:

    • Western blotting with antibodies against specific lipoproteins

    • Pulse-chase experiments to track lipoprotein maturation

    • Site-directed mutagenesis of lipoprotein processing sites

This comprehensive approach would provide valuable insights into which pneumococcal lipoproteins are most affected by LspA deficiency and how this impacts bacterial physiology and host interactions.

What is the relationship between S. pneumoniae LspA and TLR2-mediated immune responses?

S. pneumoniae lipoproteins are recognized by Toll-like receptor 2 (TLR2) on host immune cells, triggering inflammatory responses crucial for bacterial clearance. Recent research has revealed important insights into the relationship between LspA and TLR2-mediated immunity:

  • LspA-processed lipoproteins as TLR2 ligands: Properly processed lipoproteins containing the N-acyl-S-diacylglyceryl cysteine moiety serve as potent TLR2 agonists. LspA deficiency disrupts this processing, resulting in lipoproteins with altered TLR2 stimulatory capacity .

  • Reduced NF-κB activation: LspA-deficient strains showed decreased ability to activate NF-κB in THP-1 cells, suggesting impaired TLR2 signaling . This indicates that LspA-dependent lipoprotein processing is crucial for optimal TLR2 recognition.

  • Diminished cytokine production: Host cells exposed to LspA-deficient pneumococci produced lower levels of proinflammatory cytokines, consistent with reduced TLR2-mediated immune activation .

  • Potential immune evasion mechanism: The decreased immunostimulatory potential of LspA-deficient strains suggests that modulation of LspA activity could potentially serve as an immune evasion strategy during pneumococcal infection.

These findings highlight the critical role of LspA in generating mature lipoproteins that effectively engage TLR2, thus shaping the host immune response to S. pneumoniae infection.

What are the optimal methods for generating LspA-deficient S. pneumoniae strains?

Creating LspA-deficient S. pneumoniae strains requires careful genetic manipulation approaches that maintain bacterial viability while effectively eliminating LspA function. Based on recent successful generation of such strains , the following methodological approaches are recommended:

Method 1: Allelic Replacement

  • Design homologous flanking regions (≥1 kb) surrounding the lspA gene

  • Create a construct where these flanking regions surround an antibiotic resistance marker

  • Transform S. pneumoniae with the linear DNA fragment

  • Select transformants on appropriate antibiotic media

  • Confirm deletion by PCR, sequencing, and expression analysis

Method 2: CRISPR-Cas9 Approach

  • Design sgRNA targeting the lspA coding sequence

  • Create a repair template with homology arms and desired modifications

  • Co-transform cells with Cas9, sgRNA, and repair template

  • Screen colonies for successful editing

  • Confirm mutations through sequencing

Verification Protocol:

  • Genomic PCR to confirm gene deletion/modification

  • RT-qPCR to confirm absence of transcript

  • Western blot analysis using anti-LspA antibodies

  • Triton X-114 phase separation to assess global lipoprotein profiles

  • Functional assays to confirm phenotypic changes

What techniques are most reliable for evaluating the immunological impact of LspA-deficient S. pneumoniae?

To comprehensively assess the immunological consequences of LspA deficiency in S. pneumoniae, researchers should implement the following validated techniques:

In Vitro Immune Response Assessment:

  • Cell Culture Models:

    • THP-1 human monocytic cell line (as used in recent studies)

    • Primary human or mouse macrophages/dendritic cells

    • Respiratory epithelial cell lines

  • Activation Markers:

    • NF-κB reporter assays (luciferase-based)

    • MAPK phosphorylation analysis by Western blotting

    • Flow cytometry for cell surface markers (CD80, CD86, MHC-II)

  • Cytokine Production:

    • ELISA for secreted cytokines (TNF-α, IL-6, IL-1β)

    • Multiplex bead arrays for comprehensive cytokine profiling

    • qRT-PCR for cytokine gene expression

In Vivo Models:

  • Mouse Infection Models:

    • Intranasal colonization model

    • Pneumonia model

    • Invasive disease model

  • Parameters to Assess:

    • Bacterial burden in relevant tissues

    • Histopathological examination

    • Inflammatory cell recruitment (flow cytometry)

    • Local and systemic cytokine levels

    • Survival analysis

This multi-modal approach provides a comprehensive view of how LspA deficiency affects S. pneumoniae interaction with host immunity across different biological scales.

How can researchers differentiate between effects caused by LspA deficiency versus other lipoprotein processing enzymes?

Differentiating the specific effects of LspA deficiency from those caused by other lipoprotein processing enzymes requires careful experimental design. The following methodological approach is recommended:

Sequential Gene Knockout Strategy:

  • Generate single mutants lacking individual processing enzymes (ΔlspA, Δlgt)

  • Create double mutants (ΔlspAΔlgt) where applicable

  • Compare phenotypes across all strains to identify enzyme-specific effects

Complementation Analysis:

  • Develop genetic complementation constructs expressing wild-type LspA

  • Create point mutants affecting catalytic residues of LspA

  • Introduce these constructs into LspA-deficient strains

  • Assess restoration of wild-type phenotypes

Target Substrate Analysis:

  • Identify specific lipoprotein substrates using proteomics approaches

  • Examine processing patterns of individual lipoproteins in different mutant backgrounds

  • Use purified enzymes in reconstituted systems to confirm direct processing relationships

Comparative Table: Expected Effects of Lipoprotein Processing Enzyme Deficiencies in S. pneumoniae

ParameterLspA DeficiencyLgt DeficiencyDouble Deficiency
Lipoprotein AnchoringImpaired processing but initial lipidation intactNo lipid anchoringNo lipid anchoring
Cell Wall IntegrityModerately affectedSeverely affectedSeverely affected
TLR2 ActivationDecreased AbolishedAbolished
Growth RateSlightly reducedSignificantly reducedSignificantly reduced
Antibiotic SusceptibilityIncreased for cell wall antibioticsHighly increasedHighly increased
Immune EvasionPartially enhancedEnhancedEnhanced

This systematic approach will help researchers attribute observed phenotypes to specific steps in the lipoprotein processing pathway.

How should researchers analyze transcriptomic data to identify compensatory mechanisms in LspA-deficient strains?

When analyzing transcriptomic data from LspA-deficient S. pneumoniae strains, researchers should implement the following analytical workflow to identify potential compensatory mechanisms:

Recommended Analytical Pipeline:

  • Quality Control and Preprocessing:

    • Filter low-quality reads and perform adapter trimming

    • Map processed reads to the S. pneumoniae reference genome

    • Quantify gene expression (raw counts, FPKM, or TPM)

  • Differential Expression Analysis:

    • Compare LspA-deficient vs. wild-type strains using DESeq2, edgeR, or limma

    • Apply appropriate statistical thresholds (FDR < 0.05, fold change > 1.5)

    • Generate volcano plots highlighting most significant changes

  • Pathway Analysis:

    • Perform Gene Ontology enrichment analysis

    • Map differentially expressed genes to KEGG pathways

    • Use STRING or Cytoscape for protein-protein interaction network analysis

  • Specific Compensatory Pattern Recognition:

    • Identify upregulated membrane protein processing pathways

    • Focus on alternative secretion systems

    • Examine stress response regulons (e.g., CiaR, LiaR, VicRK)

    • Analyze cell wall synthesis and remodeling pathways

  • Integration with Other Omics Data:

    • Correlate transcriptomic changes with proteomic alterations

    • Connect gene expression changes to observed phenotypes

    • Validate key findings using RT-qPCR and protein expression analysis

This approach will help identify genome-wide adaptations that S. pneumoniae employs to compensate for the loss of LspA function, providing insights into bacterial adaptation mechanisms.

What are the key considerations when interpreting proteomics data from studies on S. pneumoniae LspA?

When interpreting proteomics data from studies comparing wild-type and LspA-deficient S. pneumoniae, researchers should consider the following key factors:

Technical Considerations:

  • Sample preparation impact: Different extraction methods may bias detection of certain lipoproteins. Triton X-114 phase separation is particularly effective for enriching membrane-associated lipoproteins .

  • Dynamic range limitations: Highly abundant proteins may mask detection of low-abundance lipoproteins. Consider using fractionation techniques to improve coverage.

  • Search algorithm parameters: For lipoprotein identification, database search parameters must account for lipid modifications and signal peptide cleavage sites.

Biological Interpretation Factors:

  • Primary vs. secondary effects: Not all proteomic changes will be direct results of LspA deficiency; some may reflect downstream adaptations.

  • Processing intermediates: Accumulation of lipoprotein precursors with uncleaved signal peptides indicates direct LspA substrates.

  • Functional categories: Analyze whether specific functional categories of lipoproteins (transport, adhesion, immune evasion) are differentially affected.

  • Localization shifts: LspA deficiency may cause mislocalization of lipoproteins, affecting their detection in different cellular fractions.

  • Post-translational stability: Improperly processed lipoproteins may have altered stability, affecting steady-state levels independent of expression.

How can researchers resolve contradictory findings regarding LspA function across different S. pneumoniae strains?

Resolving contradictory findings regarding LspA function across different S. pneumoniae strains requires a systematic approach that accounts for strain-specific variations:

Methodological Framework for Resolving Contradictions:

  • Standardized Experimental Design:

    • Use consistent growth conditions across all strains

    • Employ identical genetic modification strategies

    • Apply uniform phenotypic assays with appropriate controls

    • Include reference strains (TIGR4, D39, R6) alongside clinical isolates

  • Strain Genomic Characterization:

    • Perform whole-genome sequencing of all strains

    • Identify polymorphisms in lspA and related genes

    • Analyze genomic context of lspA (operon structure, regulatory elements)

    • Examine strain-specific lipoprotein repertoires (pan-genome analysis)

  • Comparative Phenotypic Analysis:

    • Create a standardized phenotype matrix across strains

    • Quantify phenotype severity using objective metrics

    • Perform hierarchical clustering to identify strain groupings

    • Correlate phenotypic patterns with genomic features

  • Cross-Laboratory Validation:

    • Exchange strains between laboratories reporting contradictory results

    • Implement round-robin testing with standardized protocols

    • Conduct meta-analysis of published data with attention to methodological differences

  • Experimental Resolution Approaches:

    • Perform allelic replacement experiments swapping lspA variants between strains

    • Create chimeric constructs to identify functional domains responsible for strain-specific effects

    • Test the impact of strain-specific genetic backgrounds by introducing identical lspA mutations into different strains

This systematic approach can help determine whether contradictory findings stem from genuine biological differences between pneumococcal strains or from methodological variations.

What are the most promising therapeutic applications targeting S. pneumoniae LspA?

Based on current understanding of LspA's role in pneumococcal biology and host interactions, several promising therapeutic approaches could be developed:

Potential Therapeutic Strategies:

  • Small-Molecule LspA Inhibitors:

    • Development of specific inhibitors targeting the catalytic site of LspA

    • Structure-based drug design using bacterial type II signal peptidase crystal structures

    • High-throughput screening of compound libraries against recombinant LspA

    • Repurposing of existing globomycin-like antibiotics that target LspA

  • Immunomodulatory Approaches:

    • Targeting the interface between LspA-processed lipoproteins and TLR2

    • Development of synthetic lipopeptides that competitively inhibit TLR2 stimulation

    • Engineering modified lipoproteins that trigger more effective immune responses

  • Combination Therapy Strategies:

    • Pairing LspA inhibitors with conventional antibiotics to enhance efficacy

    • Combining with anti-virulence agents targeting other surface proteins

    • Dual targeting of different lipoprotein processing enzymes (LspA and Lgt)

  • Vaccine Development:

    • Utilizing conserved regions of LspA as vaccine antigens

    • Developing attenuated LspA-deficient strains as live vaccines

    • Creating subunit vaccines based on immunodominant LspA-processed lipoproteins

Each of these approaches has distinct advantages and challenges, requiring further investigation to determine clinical potential and development pathways.

What novel experimental techniques could advance our understanding of S. pneumoniae LspA function?

Several cutting-edge experimental approaches could significantly enhance our understanding of S. pneumoniae LspA:

Advanced Methodologies for LspA Research:

  • Structural Biology Approaches:

    • Cryo-EM analysis of LspA in membrane environments

    • X-ray crystallography of LspA in complex with substrate peptides

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

    • NMR spectroscopy to identify binding interactions

  • Advanced Genetic Techniques:

    • CRISPR interference (CRISPRi) for tunable repression of lspA

    • Inducible gene expression systems for temporal control of LspA function

    • Transposon-sequencing (Tn-seq) to identify genetic interactions with lspA

    • Site-saturation mutagenesis to map critical functional residues

  • Innovative Imaging Approaches:

    • Super-resolution microscopy to visualize LspA localization

    • FRET-based reporters to monitor LspA-substrate interactions in live cells

    • Correlative light and electron microscopy to examine structural consequences of LspA deficiency

    • Expansion microscopy for detailed visualization of pneumococcal surface architecture

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Machine learning algorithms to predict LspA substrates and regulatory networks

    • Single-cell RNA-seq to uncover population heterogeneity in LspA function

    • Global lipidomics analysis to examine membrane composition changes

These innovative techniques would provide deeper insights into the molecular mechanisms, cellular consequences, and physiological importance of LspA in pneumococcal biology.

How might environmental factors influence LspA function and expression in S. pneumoniae?

Environmental factors likely play significant roles in modulating LspA function and expression in S. pneumoniae, with important implications for pathogenesis:

Key Environmental Influences on LspA:

  • Host Niche Adaptation:

    • Changes in temperature (nasopharynx vs. lower respiratory tract vs. blood)

    • Oxygen availability (aerobic vs. microaerobic environments)

    • pH variations (acidic conditions in phagolysosomes)

    • Nutrient availability (metal ion limitation in host tissues)

  • Stress Response Integration:

    • Oxidative stress (neutrophil respiratory burst)

    • Antibiotic exposure (cell wall stress)

    • Nutrient limitation (carbon source shifts)

    • Biofilm vs. planktonic growth states

  • Regulatory Mechanisms:

    • Two-component systems likely to regulate lspA (TCS07, CiaRH)

    • Global regulators responding to metabolic shifts

    • Small RNA-mediated post-transcriptional regulation

    • Potential autoregulation through feedback mechanisms

  • Experimental Approaches to Investigate Environmental Regulation:

    • Reporter gene fusions to monitor lspA promoter activity

    • RNA-seq under diverse environmental conditions

    • ChIP-seq to identify transcription factor binding sites

    • Pulse-chase labeling to assess LspA turnover rates

Understanding these environmental influences on LspA function would provide insights into pneumococcal adaptation during infection and could reveal potential intervention points that exploit condition-specific vulnerabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.