Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC1

YidC1 belongs to the YidC/Oxa1/Alb3 family of membrane protein insertases, which facilitate the co-translational and post-translational insertion of membrane proteins in bacteria. In Streptococcus pneumoniae, yidC1 is encoded by the yidC1 gene (also known as spr1790) and spans amino acids 23–308 (UniProt ID: Q8DNE1) . Recombinant yidC1 is produced in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for structural and functional studies, often fused with tags like His for purification .

Comparative Analysis: YidC1 vs. YidC2

In S. mutans, YidC1 and YidC2 exhibit distinct functional overlap due to differences in their C-terminal tails:

FeatureYidC1YidC2Source
Primary PathwaySRP-independent Sec translocon-mediated insertionSRP-dependent cotranslational translocation
Ribosome BindingWeak interaction (requires SRP for efficient ribosome association)Strong interaction (critical for cotranslational insertion)
Stress SensitivityMild growth defects under stress (e.g., acid, osmotic)Severe defects; essential for F₀F₁ ATPase assembly and stress tolerance
Protein SecretionIncreased extracellular protein levels (e.g., P1, GtfB) when deletedDecreased extracellular protein levels when deleted

Note: Data extrapolated from S. mutans studies; S. pneumoniae-specific yidC1/yidC2 differences remain understudied.

Interactome and Binding Partners

Interaction studies in S. mutans reveal yidC1’s network of binding partners:

  • Translocation Machinery:

    • SecYEG/YajC (holotranslocon components) .

    • Ffh/FtsY (SRP components), though interactions are weaker compared to YidC2 .

  • Chaperones:

    • DnaK (Hsp70 homolog) and RopA (rpoA) .

  • Substrates:

    • Hemolysin (SMU_1693), PTS transporters, and Rgp proteins (linked to bacitracin resistance) .

Applications in Research and Vaccine Development

Recombinant yidC1 is utilized in:

  • Structural Studies: Elucidating membrane protein folding mechanisms .

  • Vaccine Targets: As a serotype-independent antigen for pneumococcal vaccines .

  • Antibiotic Resistance: Investigating bacitracin resistance mechanisms in S. mutans .

Key Research Findings

  1. Functional Redundancy: In S. pneumoniae, YidC2 is less critical than in S. mutans, suggesting yidC1 may compensate for some SRP-dependent functions .

  2. Nutritional Defects: SRP-deficient S. pneumoniae mutants exhibit auxotrophy, but yidC1 alone does not fully rescue this phenotype .

  3. Biofilm Formation: YidC1 contributes to biofilm stability in S. mutans, though its role in S. pneumoniae remains uncharacterized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC1; spr1790; Membrane protein insertase YidC 1; Foldase YidC 1; Membrane integrase YidC 1; Membrane protein YidC 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-308
Protein Length
Full Length of Mature Protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
yidC1
Target Protein Sequence
CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHE ELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as some lipoproteins.

Database Links

KEGG: spr:spr1790

STRING: 171101.spr1790

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of bacterial YidC proteins and how does this relate to their insertase function?

YidC proteins are integral membrane proteins that function as chaperones and insertases, playing a crucial role in membrane protein translocation across bacterial membranes. The basic structure of bacterial YidC proteins includes five transmembrane domains (TMDs), two cytoplasmic loops (C1 and C2), and a cytoplasmic tail (T) . This architecture creates a hydrophilic groove that interacts transiently with transmembrane segments of nascent integral membrane proteins during their insertion .

The functional significance of this structural arrangement is particularly evident in the first transmembrane region (TM1), which contains a highly conserved arginine residue (R73 in Bacillus YidC1) that is essential for function in many YidC orthologs . This positively charged residue is hypothesized to form salt-bridges with client proteins that have acidic residues in their amino-terminal regions, facilitating their membrane insertion . The presence and positioning of charged residues within the hydrophilic groove significantly impacts the insertase functionality and substrate specificity.

How do YidC1 and YidC2 paralogs differ functionally in Gram-positive bacteria?

Most Gram-positive bacteria, unlike Escherichia coli, contain two YidC paralogs (YidC1 and YidC2) with distinct functional attributes despite their structural similarities . Research has identified several key phenotypic differences between these paralogs:

PhenotypeYidC1 Deletion (ΔyidC1)YidC2 Deletion (ΔyidC2)
Acid stress responseMinor impactIncreased sensitivity
Osmotic stress toleranceMinor impactSignificantly reduced
Zinc excess sensitivitySignificantly increasedMinor impact
Iron/Manganese handlingAlteredLess affected

YidC1 appears more structurally flexible, tolerating cytoplasmic domain substitutions better than YidC2, which demonstrates preferences for specific domain combinations to maintain functionality . This suggests YidC1 and YidC2 have evolved specialized roles for inserting different subsets of membrane proteins, with YidC2 being more critical under stress conditions while YidC1 plays a significant role in metal homeostasis.

The differential functionality extends to regulatory mechanisms as well. In Bacillus subtilis, YidC1 inserts a protein called MifM into the membrane, which serves as a sensor of YidC1 function and regulates the expression of yidC2 . This regulatory relationship highlights the interconnected yet distinct roles these paralogs play in cellular physiology.

What approaches can be used to engineer chimeric YidC proteins for functional domain analysis?

Chimeric protein engineering provides powerful insights into domain-specific functions of YidC paralogs. The following methodological framework has proven effective:

  • Domain identification and swap design: First, identify the cytoplasmic domains (CD) that differ between YidC1 and YidC2. For streptococcal YidC proteins, this includes two cytoplasmic loops (C1, C2) and the C-terminal tail (T) .

  • Construct generation: Create a comprehensive panel of chimeric constructs covering all possible domain combinations:

    • Single domain swaps (C1, C2, or T)

    • Double domain swaps (C1+C2, C1+T, C2+T)

    • Triple domain swaps (C1+C2+T)

  • Chromosomal integration: For physiologically relevant analysis, integrate these chimeric genes into the bacterial chromosome at a neutral locus (such as gtfA) rather than using plasmid-based expression, which can create artifacts due to varying copy numbers .

  • Background strain preparation: Generate a strain lacking both endogenous yidC1 and yidC2 to eliminate interference from native insertases when assessing chimeric protein function .

  • Phenotypic characterization: Assess growth and survival under both non-stress and stress conditions (acid, osmotic, metal excess) to identify domain-specific contributions to function .

What methods are effective for assessing the impact of YidC mutations on stress response and metal homeostasis?

When evaluating how YidC mutations affect stress responses and metal homeostasis, multiple complementary approaches yield the most comprehensive insights:

  • Growth curve analysis: Monitor bacterial growth kinetics in liquid culture with automated plate readers under:

    • Standard conditions (control)

    • Acid stress (reduced pH)

    • Osmotic stress (elevated NaCl)

    • Metal excess (varying concentrations of Zn(II), Fe(II), Mn(II))

  • Spot dilution assays: Prepare serial dilutions of bacterial cultures and spot onto solid media containing stressors to visualize growth differences more clearly .

  • Reporter gene assays: Implement translational fusions (such as yidC2'-lacZ) to measure how YidC1 variants affect the insertion of regulatory proteins like MifM, which controls yidC2 expression . This approach provides quantitative data measured in Miller Units.

  • Protein expression analysis: Use western blotting to confirm proper expression levels of the YidC variants to ensure phenotypic differences aren't simply due to expression disparities .

  • In silico structural analysis: Apply computational tools like I-TASSER to predict 3D structures of YidC variants and compare them with wild-type proteins using RMSD values to quantify structural deviations .

The combination of these methods provides a multi-dimensional assessment of how specific mutations affect YidC function across different cellular processes and stress conditions.

How do cytoplasmic domain interactions contribute to structural stability and functional specificity in YidC paralogs?

Research into the structural dynamics of YidC proteins has revealed sophisticated intramolecular interactions that significantly impact both stability and function. Cytoplasmic domains, despite being less conserved than transmembrane regions, play critical roles through specific salt-bridge interactions:

  • Paralog-specific interaction patterns:

    • In YidC1, computational analysis predicts salt-bridges between the C1 and C2 loops, involving residues K91 and E190 .

    • In YidC2, salt-bridges appear to form between the C1 loop and C-terminal tail, specifically between residues E92 and K253 .

  • Experimental validation through site-directed mutagenesis:
    When these key salt-bridge-forming residues are substituted with alanine, the resulting mutants display phenotypes similar to complete deletion of the respective YidC paralog, confirming their functional importance .

  • Domain synergy effects:
    Domain swapping experiments reveal that optimal function typically occurs when the C1 loop and C-terminal tail originate from the same paralog . This pattern suggests these domains co-evolved to work together, with their interaction being crucial for proper protein function.

  • Structural rigidity differences:
    YidC1 demonstrates greater structural plasticity, with most domain swaps substantially altering its predicted 3D structure (higher RMSD values) . In contrast, YidC2 maintains its core structure more rigidly across most domain substitutions, except when the C1 loop or both C1 and C2 loops are replaced .

These findings highlight how subtle electrostatic interactions between cytoplasmic domains contribute significantly to the structural stability and functional specificity of YidC paralogs, potentially guiding their evolution toward distinct cellular roles.

What is the relationship between charged residues in the hydrophilic groove and YidC1 function under stress conditions?

The hydrophilic groove within YidC proteins serves as a critical substrate interaction site, with charged residues playing particularly important roles in determining functional capabilities under stress conditions:

  • Charge distribution significance:
    In Bacillus subtilis YidC1, researchers identified that variants containing at least two, and in some cases three, positively charged residues in the hydrophilic groove could better tolerate stress conditions induced by high σM regulon expression .

  • Position-specific effects:
    Through systematic mutagenesis, researchers discovered that:

    • The conserved R73 residue in TM1 provides the baseline positive charge

    • Additional positive charges can be functionally introduced at specific positions, such as K140

    • The increased positive charge enhances insertase/foldase activity for specific stress-related membrane proteins

  • Charge combinations and constraints:
    Analysis of 103 functional YidC1 mutants revealed:

    • 88 contained a nominal double positive charge (+2) in 13 unique combinations

    • 15 contained a nominal triple positive charge (+3) in 4 unique combinations

    • No functional variant had more than one positive charge in TM1

    • TM2 and TM5 could each accommodate double positive charges

  • Functional threshold:
    The data indicates that an effective charge of between +2 and +3 in the hydrophilic groove is optimal for facilitating the recruitment and insertion of stress-related membrane proteins, while higher charges may be detrimental to insertase activity or stability .

This charge-function relationship appears to be a fundamental mechanism by which cells adapt their membrane protein insertion machinery to accommodate increased demands during stress responses.

How should researchers interpret seemingly contradictory phenotypes in YidC domain swap experiments?

Domain swap experiments frequently yield complex, sometimes seemingly contradictory results that require nuanced interpretation. Consider these methodological approaches:

  • Context-dependent interpretation:
    The impact of domain substitutions can vary dramatically depending on the phenotype being evaluated. For example, the YidC2-C2 chimera demonstrated severely impaired growth under osmotic stress but improved growth in the presence of excess Mn(II) and Fe(II) . This indicates that domain functions are conditionally beneficial or detrimental based on the specific cellular process examined.

  • Intramolecular interaction analysis:
    Apparent contradictions often reflect complex interaction networks within the protein. For instance, the C1 loop and C-terminal tail typically function optimally when paired from the same paralog, but this relationship can be obscured when all three domains are transferred simultaneously . This suggests that tertiary interactions between domains create emergent properties not predictable from individual domain functions.

  • Substrate-specific effects:
    Different YidC clients may require different structural features for optimal insertion. Researchers should consider that:

    • Phenotypic differences may reflect differential effects on distinct substrate sets

    • Future identification of YidC1-specific versus YidC2-specific substrates will be crucial for interpreting contradictory phenotypes

  • Quantitative comparison:
    When facing contradictory data, detailed quantitative analysis with appropriate statistical methods is essential. Measuring growth rates, final cell yields, and stress survival ratios provides more robust evidence than qualitative assessments alone.

  • Multi-method validation:
    Complementary approaches (growth curves, spot assays, reporter gene expression) should be employed to confirm whether contradictory phenotypes reflect genuine biological complexity or methodological artifacts.

These interpretive strategies help researchers navigate the complex landscape of structure-function relationships in YidC proteins, where simple linear relationships between domains and functions rarely exist.

What techniques can resolve structure-function relationships between YidC1 and metal ion homeostasis?

Understanding how YidC1 influences metal homeostasis requires specialized experimental approaches that connect insertase activity to cellular metal handling:

  • Metal-specific growth profiling:
    Systematic evaluation of growth responses to varying concentrations of different metals (Zn, Fe, Mn) reveals distinct patterns:

    Metal IonYidC1 ImpactYidC2 ImpactKey Domain Contributions
    Zn(II)Critical for toleranceMinor roleYidC1 C1+T combination important
    Fe(II)Moderate roleMinor roleYidC1 C2 loop enhances tolerance
    Mn(II)Moderate roleMinor roleYidC1 C2 loop strongly enhances tolerance
  • Identification of metal-related substrates:
    Membrane proteomics comparing wild-type, ΔyidC1, and YidC1 domain-swap strains can identify differentially expressed metal transporters or efflux systems that depend on YidC1 for proper membrane insertion .

  • Metal-specific transporter assays:
    Directly measure the activity of key metal transporters (import or efflux systems) in strains with different YidC1 variants to determine if altered metal homeostasis stems from changes in:

    • Transporter insertion efficiency

    • Transporter folding/conformation

    • Transporter stability in the membrane

  • Intracellular metal quantification:
    Techniques such as inductively coupled plasma mass spectrometry (ICP-MS) can quantify intracellular metal concentrations, revealing whether YidC1 variants affect net metal accumulation or distribution .

  • Structure prediction integration:
    Correlate experimental metal tolerance data with predicted structural features of YidC1 variants to identify specific regions or residues that influence interaction with metal transport proteins.

These approaches collectively build a mechanistic understanding of how YidC1's insertase activity contributes to metal homeostasis, potentially revealing novel therapeutic targets in bacterial pathogens like S. pneumoniae.

How can researchers differentiate between direct and indirect effects of YidC mutations on cellular phenotypes?

Distinguishing direct from indirect effects of YidC mutations presents a significant challenge in functional genomics research. The following methodological framework helps address this complexity:

  • Substrate identification and validation:

    • Conduct membrane proteomics comparing wild-type and YidC mutant strains to identify proteins with altered membrane incorporation

    • Use co-immunoprecipitation or crosslinking studies to identify direct YidC1 client proteins

    • Perform in vitro insertion assays with purified YidC variants and candidate substrates to confirm direct interactions

  • Regulatory network analysis:

    • Utilize reporter fusions like yidC2'-lacZ to monitor how YidC1 variants affect regulatory systems

    • This approach identified that YidC1 directly inserts MifM, which regulates yidC2 expression, creating potential indirect effects through altered YidC2 levels

    • Measure YidC2 levels in YidC1 mutant strains to account for compensatory effects

  • Complementation experiments:

    • Express specific membrane proteins (identified as potentially affected by YidC mutations) from inducible promoters

    • If expression of a single protein rescues a complex phenotype, it suggests that protein is a key direct substrate whose absence causes downstream indirect effects

  • Temporal analysis:

    • Monitor phenotypic changes immediately after induction of mutant YidC proteins versus long-term adaptation

    • Rapid phenotypic changes more likely represent direct effects, while delayed changes often reflect indirect, compensatory responses

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis with YidC variants to identify genetic interactions

    • Proteins showing genetic interactions with YidC may be direct substrates or function in parallel pathways

By implementing these approaches, researchers can build a hierarchical model of how YidC mutations directly affect specific substrate proteins and how these primary effects propagate through cellular networks to create the observed phenotypes.

What emerging technologies could advance our understanding of YidC1 structure-function relationships?

Several cutting-edge technologies show particular promise for elucidating YidC1 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of YidC1 in complex with substrate proteins during the insertion process

    • Particularly valuable for capturing transient intermediates without crystallization

    • Could reveal how the hydrophilic groove accommodates different substrates and how cytoplasmic domain interactions change during the insertion cycle

  • AlphaFold2 and integrative structural modeling:

    • Going beyond I-TASSER predictions used in current research

    • Can model YidC1-substrate complexes with higher accuracy

    • Allows prediction of how mutations alter dynamic protein-protein interactions

  • Single-molecule fluorescence resonance energy transfer (smFRET):

    • Enables real-time monitoring of YidC1 conformational changes during substrate insertion

    • Can identify whether different substrates induce distinct conformational states

    • Particularly valuable for understanding how cytoplasmic domain interactions identified through domain swapping experiments contribute to the insertion mechanism

  • Ribosome profiling coupled with site-specific crosslinking:

    • Identifies nascent chains interacting with YidC1 co-translationally

    • Helps distinguish YidC1-specific versus YidC2-specific substrates

    • Can resolve the timing of YidC1 engagement with different classes of membrane proteins

  • Genome-wide CRISPRi screens under different stress conditions:

    • Identifies genetic interactions that modify YidC1 phenotypes

    • Helps map the broader cellular networks in which YidC1 functions

    • Particularly relevant for understanding metal homeostasis connections revealed in current research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.