Recombinant Streptococcus pneumoniae Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Streptococcus pneumoniae Membrane Protein Insertase YidC (yidC)

Recombinant Streptococcus pneumoniae YidC refers to engineered versions of the bacterial membrane insertase YidC, produced via heterologous expression systems (e.g., E. coli) for research or therapeutic applications. This protein facilitates the insertion and folding of membrane proteins, either independently or in coordination with the Sec translocase system. Its recombinant form retains critical functional domains, including hydrophobic transmembrane segments (TM3 and TM5) that mediate substrate binding and membrane integration .

Functional Roles

YidC operates in two modes:

  1. Sec-dependent: Assists SecY in inserting multi-spanning membrane proteins (e.g., ATP synthase subunits) .

  2. Sec-independent: Directly inserts small single-span proteins (e.g., phage coat proteins) .

Experimental Validation:

  • In vitro reconstitution: Purified YidC inserted Pf3 coat protein into proteoliposomes, confirming Sec-independent activity .

  • Complementation studies: S. pneumoniae ΔyidC2 mutants showed reduced genetic transformation but retained viability, unlike S. mutans .

Expression Systems

Recombinant YidC is typically produced in E. coli due to its high yield and compatibility with bacterial secretion pathways .

ParameterDetailsSource
Expression vectorpTRC99A or pET-derived plasmids
Purification tagN-terminal His-tag (e.g., residues 23–276 in YidC2)
Yield~150 Pf3 coat proteins inserted per YidC molecule in proteoliposomes

Research Applications

  • Membrane protein studies: Used to dissect insertion mechanisms of FoF<sub>1</sub>-ATPase subunits and M13 procoat .

  • Vaccine development: ΔscRNA and ΔyidC2 mutants in S. pneumoniae show attenuated virulence, suggesting potential vaccine candidates .

Synergy with Signal Recognition Particle (SRP) Complex

While YidC is critical for membrane protein biogenesis, its function partially overlaps with the SRP pathway in S. pneumoniae:

  • SRP mutants (ΔscRNA, Δffh, ΔftsY) exhibited severe growth defects and impaired genetic transformation, unlike ΔyidC1/2 .

  • YidC2 failed to rescue SRP-deficient lethality in S. pneumoniae, contrasting with S. mutans .

Substrate Specificity

SubstrateYidC DependencySec DependencySource
FoF<sub>1</sub>-ATPaseHigh (YidC-5S inhibits insertion)Low
Pf3 coat proteinModerateNone
Competence pili proteinsLow (ΔyidC2 shows partial defect)High (via SRP)

Role in Virulence

  • Genetic competence: YidC2 contributes to DNA uptake and transformation in S. pneumoniae, enabling horizontal gene transfer .

  • Antibiotic resistance: ΔyidC1/2 mutants may alter cell wall integrity, potentially affecting β-lactam susceptibility .

Potential Therapeutic Targets

  • Vaccine attenuation: ΔscRNA mutants show reduced virulence in mouse models, suggesting serotype-independent vaccine approaches .

  • Antibacterial strategies: Disrupting YidC-SecY interactions could target essential membrane protein biogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
yidC; SPT_1955; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-308
Protein Length
Full Length of Mature Protein
Species
Streptococcus pneumoniae (strain Taiwan19F-14)
Target Names
yidC
Target Protein Sequence
CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVRE ELAKNPPKASAFSKPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC participates in the integration of membrane proteins dependent and independent of the Sec translocase complex, and also integrates some lipoproteins.
Database Links

KEGG: snt:SPT_1955

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC insertase in Streptococcus pneumoniae?

YidC insertases in S. pneumoniae function as membrane protein translocases that facilitate the insertion of proteins into the bacterial membrane without consuming energy, using primarily hydrophobic forces . Unlike the Signal Recognition Particle (SRP) complex components (ScRNA, Ffh, and FtsY) which are GTPases requiring energy consumption, YidC insertases offer growth advantages to streptococci, which acquire energy solely through glycolysis and fermentation processes with limited ATP yield . S. pneumoniae possesses two YidC variants (YidC1 and YidC2) that participate in inserting key membrane proteins essential for pneumococcal physiology, including components of competence pili and potentially the F₀F₁ATPase complex .

What is the current understanding of YidC conservation across bacterial species?

YidC or its counterparts (Oxa1 and Oxa2 in mitochondria) are present in almost all organisms, indicating strong evolutionary conservation . In streptococcal species, including S. pneumoniae, S. mutans, and S. pyogenes, YidC insertases appear to have evolved to play especially important roles in membrane protein insertion . Different selective pressures in various ecological niches have shaped how these species rely on YidC versus SRP components. For example, S. mutans, which lives in the acidic oral cavity, heavily depends on YidC2 for proper assembly of F₀F₁ATPase, essential for extruding H⁺ to maintain intracellular homeostasis . In contrast, S. pneumoniae, which inhabits the nasopharyngeal space without similar acid stress, shows a more balanced usage of SRP and YidC2 components .

What are the most effective methods for generating YidC mutants in S. pneumoniae?

Effective generation of YidC mutants in S. pneumoniae can be achieved through a targeted gene replacement approach. The methodology involves transforming parental strains (such as D39 or R6) with a PCR product containing an antibiotic resistance gene (erythromycin or kanamycin) flanked by sequences homologous to the regions upstream and downstream of the target gene . Assembly of these constructs can be efficiently performed using the Gibson Assembly method . The transformed cells are then plated onto THY agar supplemented with 3% horse serum and appropriate antibiotics to select for successful transformants .

For verification of correct gene replacement, PCR amplification of the target region followed by sequencing should be performed . This approach has been successfully applied to create ΔyidC1 and ΔyidC2 mutants, allowing researchers to study their specific roles in S. pneumoniae biology.

How should recombinant YidC be expressed for structural and functional studies?

Based on successful approaches with other S. pneumoniae recombinant proteins, the expression of recombinant YidC should employ a multivariate optimization strategy focusing on eight critical variables:

  • Media composition (yeast extract, tryptone, NaCl concentrations)

  • Carbon source (glucose or glycerol)

  • Antibiotic concentration

  • Inducer concentration

  • Cell density at induction (absorbance)

  • Post-induction temperature

  • Induction duration

  • Aeration conditions

A fractional factorial design (2^8-4) with center point replicates would efficiently identify optimal conditions . Based on successful expression of other pneumococcal proteins, the following conditions typically yield good results for soluble expression in E. coli:

  • Growth until OD₆₀₀ of 0.8

  • Induction with 0.1 mM IPTG

  • Expression at 25°C for 4 hours

  • Media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

  • Supplementation with appropriate antibiotics (30 μg/mL kanamycin)

This statistical experimental design approach has demonstrated effectiveness in producing high yields (250 mg/L) of soluble, functional recombinant proteins from S. pneumoniae .

What purification strategy provides the highest yield of functional recombinant YidC?

For membrane proteins like YidC, a specialized purification strategy is required to maintain functionality. After optimized expression, cells should be harvested by centrifugation and disrupted by sonication or high-pressure homogenization in a buffer containing mild detergents (typically n-dodecyl-β-D-maltopyranoside or CHAPS) to solubilize the membrane fraction . A two-step purification approach is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC) if a His-tag is incorporated

  • Secondary purification by size exclusion chromatography to remove aggregates and contaminants

The protein's functional activity should be assessed at each purification step to ensure the retention of its native conformation . For YidC specifically, reconstitution into liposomes may be necessary to evaluate its membrane insertion activity. When optimized, this strategy can yield protein with approximately 75% homogeneity while maintaining its functional properties .

How does YidC2 contribute to the genetic competence mechanism in S. pneumoniae?

YidC2 contributes to genetic competence in S. pneumoniae by facilitating the proper assembly and functioning of the transformation machinery, particularly components of the type IV pili (T4P) . Experimental evidence shows that ΔyidC2 mutants exhibit significantly reduced transformation rates compared to wild-type strains, though the reduction is less severe than observed in SRP component deletions .

The mechanism likely involves YidC2's role in inserting specific membrane proteins required for the T4P assembly. While YidC2 may successfully insert individual T4P proteins (ComGA, ComGB, and ComGC) into the membrane, the data suggests that complete and functional pili assembly requires highly coordinated protein synthesis and insertion . The insertase may serve as an alternative pathway for inserting non-SecY dependent proteins into the membrane, contributing to the flexibility and robustness of the competence development system .

What experimental approaches best demonstrate the differential roles of YidC1 versus YidC2 in transformation?

To effectively demonstrate the differential roles of YidC1 versus YidC2 in transformation, researchers should employ a comprehensive approach combining genetic, phenotypic, and molecular analyses:

  • Genetic transformation assays: Compare transformation frequencies between wild-type, ΔyidC1, and ΔyidC2 strains using standardized protocols. Culture cells to mid-log phase (OD₅₉₅ of 0.15), add competence-stimulating peptide (CSP1, 100 ng/mL) to induce competence, then introduce donor DNA (100 ng/mL) containing a selectable marker like streptomycin resistance . After incubation, plate serial dilutions on selective and non-selective media to calculate transformation frequencies.

  • Competence gene expression analysis: Perform qPCR measurement of early and late competence genes in wild-type and mutant strains to identify potential differences in the competence regulatory cascade .

  • Protein localization studies: Use proteomic analysis of membrane fractions from wild-type and mutant strains to identify proteins whose membrane localization is differentially affected by YidC1 versus YidC2 deletion .

  • Competence pili visualization: Employ electron microscopy to directly visualize T4P formation in wild-type and mutant strains, particularly focusing on potential differences between ΔyidC1 and ΔyidC2 .

This multi-faceted approach has revealed that while ΔyidC1 shows transformation frequencies similar to wild-type, ΔyidC2 exhibits significantly reduced transformation rates, though not as severely impaired as SRP component deletions .

What is the relationship between YidC and the SRP pathway in S. pneumoniae competence development?

The relationship between YidC and the SRP pathway in S. pneumoniae competence development represents a complex interplay of partially redundant systems with distinct specializations. Experimental evidence shows both pathways contribute to competence development, but with different levels of importance:

  • Complementary functions: YidC insertases (particularly YidC2) may compensate for some functions of the SRP pathway, especially for inserting certain membrane proteins without consuming energy through GTP hydrolysis .

  • Differential impacts on transformation: Deletion of SRP components (ΔscRNA, Δffh, Δftsy) causes more severe defects in transformation (>1000-fold reduction) compared to ΔyidC2 (~10-fold reduction), while ΔyidC1 shows minimal impact .

  • Protein-specific targeting preferences: Proteomic analysis shows that some competence-related membrane proteins depend primarily on the SRP pathway, while others may use YidC2 as an alternative insertion route .

  • T4P assembly coordination: While YidC2 may successfully insert individual T4P proteins (ComGA, ComGB, ComGC), complete pili assembly appears to require coordinated action of both pathways .

This relationship highlights the evolutionary adaptation of S. pneumoniae to ensure robust competence development through partially redundant membrane protein insertion systems, providing flexibility under different environmental conditions .

How can recombinant YidC be utilized to develop novel antimicrobial strategies against S. pneumoniae?

Recombinant YidC offers promising avenues for developing novel antimicrobial strategies against S. pneumoniae through several research approaches:

  • Structural inhibitor design: By expressing and purifying recombinant YidC, researchers can perform high-resolution structural studies to identify binding pockets suitable for small molecule inhibitor design. Targeting the functional domains of YidC2 may be particularly effective since it appears to play a more critical role in pneumococcal physiology than YidC1 .

  • Functional screening platforms: Reconstituted recombinant YidC in liposomes or nanodiscs could serve as a screening platform to identify compounds that specifically inhibit its insertase activity. Given the differences between bacterial YidC and its mammalian counterparts, such inhibitors could offer selective antimicrobial activity.

  • Attenuated vaccine development: The ΔscRNA mutant shows significant attenuation in mouse models of bacteremia and pneumonia . This suggests that targeting the membrane protein insertion pathways (including YidC) could generate attenuated strains with potential vaccine applications, particularly relevant given S. pneumoniae's responsibility for over 14 million pneumonia cases and 1 million deaths annually .

  • Combination therapy approaches: Research indicates that YidC2 may partially compensate for SRP function deficiencies . This suggests that combination therapies targeting both pathways could prevent compensatory mechanisms and enhance antimicrobial efficacy.

What techniques can be used to study the structural interactions between YidC and its substrate proteins?

Studying the structural interactions between YidC and its substrate proteins requires specialized techniques that can capture membrane protein complexes:

  • Site-specific crosslinking: Incorporate photo-activatable or chemical crosslinkers at specific positions in recombinant YidC to capture transient interactions with substrate proteins during the insertion process. This can be achieved using amber suppression technology to introduce unnatural amino acids with crosslinking capabilities.

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and can be applied to visualize YidC-substrate complexes. By stabilizing these complexes (potentially using nanobodies or disulfide crosslinking), researchers can obtain near-atomic resolution structures revealing the interaction interfaces.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can identify regions of YidC that become protected upon substrate binding, providing insights into the dynamic interactions during the membrane insertion process.

  • Fluorescence resonance energy transfer (FRET): By strategically placing fluorescent probes on YidC and substrate proteins, researchers can monitor real-time interactions and conformational changes during the insertion process.

  • Molecular dynamics simulations: Computational approaches can model the interactions between YidC and various substrate proteins, particularly useful for understanding how YidC recognizes diverse substrates like the competence proteins ComGA, ComGB, and ComGC that have been identified as potential YidC2 substrates in S. pneumoniae .

How does the energetic efficiency of YidC-mediated insertion compare with SRP-dependent pathways in different Streptococcal species?

The energetic efficiency comparison between YidC-mediated insertion and SRP-dependent pathways reveals important evolutionary adaptations among Streptococcal species:

  • Fundamental energetic differences: YidC insertases utilize hydrophobic forces to insert membrane proteins without consuming energy, while the SRP pathway components (Ffh and FtsY) are GTPases that consume energy during the targeting and insertion process . This energetic difference is particularly significant for Streptococci, which acquire energy solely from glycolysis and fermentation, yielding far less ATP than respiration .

  • Species-specific adaptations: Different Streptococcal species show varying degrees of reliance on these pathways based on their ecological niches:

    SpeciesPrimary Energy ChallengeYidC2 ImportanceSRP ImportanceKey Adaptations
    S. mutansAcidic environment requiring constant H+ extrusionCritical (similar to SRP)HighYidC2 essential for F₀F₁ATPase assembly and function
    S. pneumoniaeNasopharyngeal space (less acidic)ModerateVery highMore balanced reliance with greater SRP dependence
    S. pyogenesVarious host tissuesModerateHighSimilar pattern to S. pneumoniae
  • Growth phenotype evidence: The severity of growth defects in various mutants reflects the energetic constraints in each species. In S. mutans, ΔyidC2 exhibits the most severe growth defects (followed by ΔscRNA > Δffh > ΔftsY > ΔyidC1) . By contrast, in S. pneumoniae, Δffh and ΔftsY show more severe growth defects than ΔscRNA and ΔyidC2, suggesting different energetic optimizations .

  • Substrate-specific preferences: Proteomic analyses show that membrane proteins like F₀F₁ATPase subunits in S. pneumoniae can be inserted without significant SRP involvement, suggesting YidC2 is adequate for their function . This energy-efficient solution appears to be an evolutionary adaptation to maximize energetic efficiency based on specific environmental challenges.

How can proteomic analysis be optimized to identify YidC-dependent virulence factors in S. pneumoniae?

Optimizing proteomic analysis to identify YidC-dependent virulence factors in S. pneumoniae requires a multi-faceted approach:

  • Comparative membrane proteomics: Perform quantitative proteomics comparing membrane fractions from wild-type, ΔyidC1, and ΔyidC2 strains. Use stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling to enable precise quantification of relative protein abundances. This approach can identify membrane proteins whose localization is specifically affected by YidC deletion .

  • Sequential extraction protocol: Employ a sequential extraction protocol to separate peripheral membrane proteins from integral membrane proteins, as YidC primarily affects the latter. This typically involves:

    • Low-detergent wash to remove peripheral proteins

    • Stronger detergent extraction to solubilize integral membrane proteins

    • Analysis of both fractions to identify differential protein distributions

  • Secretome analysis: In parallel, analyze the secretome (extracellular proteins) of wild-type and mutant strains, as defects in membrane protein insertion may indirectly affect protein secretion.

  • Condition-specific induction: Perform analyses under both standard laboratory conditions and host-mimicking conditions (serum exposure, oxygen limitation, etc.) to capture virulence factors specifically expressed during infection.

  • Validation studies: Confirm YidC-dependency through complementation experiments (restoring YidC expression) and targeted assays for specific virulence functions.

This approach has successfully identified differential protein profiles between wild-type and ΔscRNA strains , and similar methodologies could identify YidC-dependent virulence factors.

What experimental designs best elucidate the differential impacts of YidC1 versus YidC2 on pneumococcal pathogenesis?

To effectively elucidate the differential impacts of YidC1 versus YidC2 on pneumococcal pathogenesis, researchers should implement a multi-dimensional experimental design:

  • In vivo infection models with isogenic mutants:

    • Compare wild-type, ΔyidC1, ΔyidC2, and complemented strains in multiple infection models:

      • Bacteremia model (intravenous infection)

      • Pneumonia model (intranasal infection)

      • Colonization model (nasopharyngeal colonization)

    • Measure bacterial loads, inflammatory responses, and survival rates

    • This approach has successfully demonstrated attenuated virulence in ΔscRNA mutants

  • Tissue-specific adaptation studies:

    • Recover bacteria from different host niches during infection

    • Perform transcriptomic and proteomic analyses to identify differentially expressed genes/proteins

    • Compare these profiles between wild-type and YidC mutants to identify niche-specific dependencies

  • Host response comparative analysis:

    • Measure host immune responses (cytokine profiles, neutrophil recruitment, etc.) to wild-type versus mutant strains

    • Identify potential differences in pathogen-associated molecular pattern (PAMP) exposure or virulence factor expression

  • Competitive infection assays:

    • Co-infect with differentially marked wild-type and mutant strains

    • Determine competitive indices in different tissues

    • This approach can reveal subtle fitness defects not apparent in single-strain infections

  • Temporal dynamics analysis:

    • Sample at multiple time points during infection progression

    • Track changes in bacterial gene expression and host response

    • Identify critical timepoints where YidC1 or YidC2 function becomes particularly important

This comprehensive experimental design would generate a detailed understanding of how YidC1 and YidC2 differentially impact pneumococcal pathogenesis, potentially revealing timepoint-specific or tissue-specific requirements for each insertase.

What emerging technologies could advance our understanding of YidC function in S. pneumoniae?

Several emerging technologies hold promise for advancing our understanding of YidC function in S. pneumoniae:

  • CryoET (cryo-electron tomography): This technique allows visualization of protein complexes in their native cellular environment at near-atomic resolution. Applied to S. pneumoniae, it could reveal the spatial organization of YidC in relation to other membrane protein insertion machinery and its substrates during active insertion processes.

  • Proximity labeling proteomics: Technologies like TurboID or APEX2 could be fused to YidC1 or YidC2 to identify proximal proteins in living cells, potentially revealing novel interaction partners and substrates that were missed in conventional proteomic approaches .

  • Single-molecule tracking: Advanced fluorescence microscopy techniques could track the dynamics of individual YidC molecules in living pneumococci, providing insights into their diffusion, clustering, and potential co-localization with substrate proteins during insertion events.

  • Synthetic biology approaches: Constructing minimal synthetic systems with defined components could help delineate the essential elements required for YidC function. This could include reconstituting YidC with specific lipids and substrate proteins in artificial membrane systems.

  • CRISPR interference (CRISPRi): This technology allows for tunable repression of gene expression rather than complete deletion, enabling studies of partial YidC depletion that might reveal threshold effects and avoid the confounding influences of complete gene deletion.

  • Ribosome profiling: This technique could identify how YidC deletion affects the translation of membrane proteins, potentially revealing co-translational insertion mechanisms specifically dependent on YidC1 or YidC2.

How might combinatorial approaches targeting both YidC and SRP pathways enhance antimicrobial strategies?

Combinatorial approaches targeting both YidC and SRP pathways represent a promising strategy for enhancing antimicrobial efficacy against S. pneumoniae:

  • Mechanistic rationale: Research demonstrates partial functional overlap between YidC insertases and the SRP pathway, with YidC2 potentially compensating for some SRP functions . This suggests that simultaneously targeting both pathways could prevent compensatory mechanisms and achieve more complete inhibition of membrane protein insertion.

  • Synergistic effects: The different energetic requirements of these pathways (YidC using hydrophobic forces without energy consumption; SRP requiring GTP hydrolysis ) suggest that dual inhibition could create an energetic crisis for the bacterium, as it would be forced to rely on less efficient insertion mechanisms.

  • Potential implementation strategies:

    • Dual-targeting inhibitors designed to bind conserved regions of both YidC and SRP components

    • Combination therapy with separate compounds targeting each pathway

    • Sequential administration to overcome adaptive responses

  • Reduced resistance development: By targeting two essential pathways simultaneously, the genetic barrier to resistance development would be significantly higher, as mutations in both systems would be required for survival.

  • Specificity enhancement: Structure-guided design could focus on pneumococcal-specific features of both YidC and SRP components, potentially improving therapeutic index by reducing effects on beneficial microbiota or host cells.

This approach is particularly relevant given that S. pneumoniae is responsible for over 14 million pneumonia cases and 1 million deaths annually, with the majority affecting children , highlighting the need for novel antimicrobial strategies.

What experimental approaches would best characterize the structural determinants of substrate selectivity between YidC1 and YidC2?

Characterizing the structural determinants of substrate selectivity between YidC1 and YidC2 requires a multi-faceted experimental approach:

  • Comparative structural analysis:

    • Express and purify recombinant YidC1 and YidC2 using optimized expression systems

    • Determine high-resolution structures using cryo-EM or X-ray crystallography

    • Perform computational analysis to identify structural differences in substrate-binding regions

  • Domain swap experiments:

    • Create chimeric proteins containing domains from both YidC1 and YidC2

    • Test these chimeras for their ability to complement specific phenotypes of ΔyidC1 and ΔyidC2 mutants

    • Map functional domains responsible for substrate specificity

  • Binding affinity measurements:

    • Develop in vitro binding assays using purified YidC1, YidC2, and candidate substrate proteins

    • Quantify binding affinities and kinetics using techniques like surface plasmon resonance

    • Identify differential binding properties that might explain substrate preferences

  • Site-directed mutagenesis:

    • Based on structural and sequence comparisons, introduce point mutations in candidate selectivity-determining regions

    • Assess the impact on substrate recognition and insertion using functional complementation assays

    • Create a map of residues critical for substrate discrimination

  • In vivo substrate profiling:

    • Use quantitative proteomics to compare membrane protein profiles in strains expressing only YidC1 or only YidC2

    • Identify proteins preferentially inserted by each insertase

    • Analyze the physicochemical properties of these substrate sets to identify recognition motifs

This comprehensive approach would generate a detailed understanding of how these two insertases, which perform similar biochemical functions, achieve substrate selectivity in S. pneumoniae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.