Recombinant Streptococcus pneumoniae Oligopeptide transport system permease protein AmiC (amiC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
amiC; spr1706; Oligopeptide transport system permease protein AmiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
amiC
Target Protein Sequence
MKKYIFMRVLRSLVSIFLVTTLTYTIIYTLVPRKLIFKQDPNYNKIATTADKRDNYENTV FERMGYIEYYDTKELQEKASSMDSSVTVEANATNKAIYEKYINQLGHGWTLGEFTESGQF YATREIPIFERVFHFYANLIDIDHTNKIQDPENPDLKRYLRFENDPAIGWSLVGSGTKHK YLLYFNSQFPFVHQNFVNLNLGDSYPTYANTPVLQVITQGQGQTKTAQVQFPTGKKTSSV NIYSRTYKSPSQADSREVASYGKDDPYTATESNYQYPSMIVSSAITGLIGLVLAYALAVP LGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGDWRSY VLPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVS GIPAAIIGVIGGATLTETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGD IWMTIIDPRIKLTEKGGK
Uniprot No.

Target Background

Function
AmiC, a component of the binding-protein-dependent transport system for oligopeptides, likely facilitates the translocation of the substrate across the membrane.
Database Links

KEGG: spr:spr1706

STRING: 171101.spr1706

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the oligopeptide transport system permease protein AmiC in Streptococcus pneumoniae?

AmiC is a transmembrane protein that functions as a critical component of the Ami permease system in S. pneumoniae. This system belongs to the ATP binding cassette (ABC) transporter family, which is responsible for the importation of oligopeptides across the bacterial cell membrane. Within this multiprotein complex, AmiC works alongside AmiD as the transmembrane components that form the channel through which oligopeptides are transported . The entire Ami permease system consists of the transmembrane proteins (AmiC and AmiD), cytosolic ATPases (AmiE and AmiF), and the cell membrane-anchored lipoprotein AmiA that binds and concentrates oligopeptides .

How does the Ami permease system contribute to S. pneumoniae nutrition and virulence?

The Ami permease system plays a dual role in S. pneumoniae biology:

  • Nutritional Function: S. pneumoniae has complex nutritional requirements, and the importation of oligopeptides via the Ami permease system is crucial for adequate nutrition and growth . Given that pneumococci rely on acquiring nutrients from their host, this system enables the bacterium to obtain essential peptides from its environment.

  • Virulence Regulation: Beyond nutritional functions, the Ami permease system also serves as a signal transduction mechanism. Many streptococcal species utilize oligopeptide transporter systems as signal transducers that can alter the expression of genes responsible for adhesion and various other virulence factors . This signaling capacity makes the Ami system significant in the pathogenesis of S. pneumoniae infections.

What structural features characterize ABC transporters like the Ami permease system?

ABC transporters like the Ami permease system typically consist of:

  • Transmembrane Domains (TMDs): Proteins like AmiC and AmiD form the channel through the membrane.

  • Nucleotide-Binding Domains (NBDs): AmiE and AmiF function as ATPases that bind and hydrolyze ATP to power transport.

  • Substrate-Binding Proteins (SBPs): AmiA and its paralogs (including AliC and AliD in nonencapsulated S. pneumoniae) bind specific substrates for delivery to the transporter.

This architecture allows for the selective and energy-dependent transport of specific substrates across the cell membrane, a process essential for bacterial survival and pathogenesis.

What expression systems are effective for producing recombinant S. pneumoniae proteins like AmiC?

Recombinant expression of S. pneumoniae proteins can be accomplished using several approaches:

E. coli Expression System:

  • Methodology: For membrane proteins like AmiC, expression typically uses E. coli strains optimized for membrane protein production (e.g., C41(DE3), C43(DE3)).

  • Vector Selection: pET series vectors with tunable promoters help control expression levels.

  • Fusion Partners: Fusion tags such as MBP (maltose-binding protein) or SUMO can enhance solubility.

  • Growth Conditions: Induction at lower temperatures (16-20°C) and reduced inducer concentrations often improves proper folding.

Evidence from similar pneumococcal recombinant protein work demonstrates that E. coli can effectively express S. pneumoniae proteins, as shown in studies with capsular polysaccharide synthesis proteins .

Expression Optimization Table:

ParameterStandard ConditionsOptimized for Membrane Proteins
E. coli strainBL21(DE3)C41(DE3) or C43(DE3)
Induction temperature37°C16-20°C
IPTG concentration1.0 mM0.1-0.5 mM
Media supplementsNoneGlycerol (5%), specific ions
Induction duration3-4 hours16-20 hours

What purification challenges are specific to membrane proteins like AmiC?

Purifying transmembrane proteins like AmiC presents several methodological challenges:

  • Detergent Selection: Critical for maintaining protein stability and function during extraction from the membrane.

    • Methodology: Sequential screening of detergents (DDM, LDAO, FC-12) at varying concentrations while monitoring protein stability through size-exclusion chromatography profiles.

  • Maintaining Native Conformation:

    • Methodology: Use of nanodiscs or liposomes for reconstitution of the purified protein into a lipid environment that mimics the native membrane.

  • Stability Assessment:

    • Methodology: Thermal shift assays (TSA) to identify buffer conditions that maximize protein stability.

  • Functional Verification:

    • Methodology: ATPase activity assays to confirm that the purified protein retains its ability to hydrolyze ATP, essential for transport function.

These methodological approaches help overcome the inherent difficulties in working with membrane proteins and increase the likelihood of obtaining functional recombinant AmiC for structural and functional studies.

How do protein-protein interactions within the Ami permease system affect oligopeptide transport?

The Ami permease system depends on precise protein-protein interactions for proper function:

  • AmiC-AmiD Interactions: These transmembrane proteins must form a stable complex to create the transport channel.

  • AmiA-AmiC Interactions: Similar to what has been observed in the interactions between AmiA and AmiC in M. smegmatis (though with different functions), the S. pneumoniae AmiA likely interacts with AmiC to transfer bound oligopeptides to the transmembrane channel .

  • Substrate-Binding Protein Interchangeability: Research indicates that AliC and AliD are paralogs of AmiA that bind unique albeit overlapping oligopeptide sequences compared to AmiA . This suggests a complex interaction network where different substrate-binding proteins may interact with the same transmembrane components.

Methodological Approach to Study These Interactions:

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation followed by mass spectrometry

  • Surface plasmon resonance to measure binding kinetics

  • Cross-linking studies followed by proteomic analysis

How does the structure-function relationship of AmiC compare to other ABC transporters?

While specific structural information about S. pneumoniae AmiC is limited in the provided search results, comparison with other well-characterized ABC transporters can provide insights:

  • Conserved Motifs: ABC transporters contain conserved Walker A and Walker B motifs for ATP binding and hydrolysis. Sequence analysis of AmiC can reveal these conserved regions.

  • Transmembrane Helices: Typically, ABC transporter permease subunits contain 6 transmembrane helices. Structural prediction using tools like PSIPRED can identify these domains in AmiC .

  • Substrate Specificity Determinants: Specific residues in the transmembrane domains determine substrate specificity. Homology modeling based on related transporters can predict these regions in AmiC.

Methodological Approach:
The methodology utilized for modeling other transporters can be applied to AmiC:

  • Secondary structure prediction using PSIPRED

  • 3D structure modeling using MODELLER with appropriate templates

  • Model validation using Ramachandran plots

  • Molecular dynamics simulations to study conformational changes during transport

What role might AmiC play in antimicrobial resistance mechanisms?

The Ami permease system's dual role in nutrition and signaling suggests potential involvement in antimicrobial resistance:

  • Antibiotic Efflux: While primarily an importer, structural changes in ABC transporters can sometimes convert them to efflux pumps. Such modifications in AmiC could potentially contribute to antibiotic export.

  • Cell Wall Remodeling Signaling: The signaling capacity of the Ami system may influence cell wall structure through downstream gene regulation, potentially affecting susceptibility to cell wall-targeting antibiotics.

  • Nutritional Adaptation: Under antibiotic stress, bacteria often modify metabolic pathways. AmiC's role in nutrient acquisition may be crucial for survival during antibiotic challenges.

  • Capsule Regulation: Given that capsule formation is crucial for S. pneumoniae virulence and can provide protection against certain antimicrobials, any influence of the Ami system on capsule production would be significant . Research shows that capsule and surface proteins like PspA have additive effects on resistance to antimicrobial peptides .

How can gene knockout studies help elucidate AmiC function in S. pneumoniae?

Methodological Approach:

  • Generation of AmiC Deletion Mutants:

    • Allelic replacement technique using a suicide vector containing flanking regions of the amiC gene

    • CRISPR-Cas9 system for precise genomic editing

  • Phenotypic Characterization:

    • Growth curve analysis in various media to assess nutritional requirements

    • Transport assays using labeled oligopeptides to measure uptake efficiency

    • Virulence assessment in infection models

  • Complementation Studies:

    • Re-introduction of wild-type and mutant amiC variants to confirm phenotype specificity

    • Site-directed mutagenesis of key residues to identify functional domains

  • Transcriptomic Analysis:

    • RNA-seq to identify genes differentially expressed in AmiC mutants

    • ChIP-seq to identify potential regulatory interactions

The significance of these approaches is illustrated by similar studies on PspA, where mutant strains lacking this protein showed increased susceptibility to antimicrobial peptides, and complementation with recombinant protein restored resistance .

What biophysical techniques are most effective for studying AmiC-substrate interactions?

Methodological Approaches:

  • Isothermal Titration Calorimetry (ITC):

    • Measures binding thermodynamics (ΔH, ΔG, ΔS)

    • Determines binding affinity (Kd) and stoichiometry

    • Methodology: Titration of purified AmiC with increasing concentrations of oligopeptides

  • Surface Plasmon Resonance (SPR):

    • Measures binding kinetics (kon, koff)

    • Allows real-time detection of interactions

    • Methodology: Immobilization of AmiC on sensor chip and flow of various oligopeptides

  • Fluorescence-based Assays:

    • Intrinsic tryptophan fluorescence to detect conformational changes

    • Fluorescently labeled substrates to track binding

    • Methodology: Monitoring fluorescence changes upon substrate addition

  • Molecular Docking and Dynamics:

    • In silico prediction of binding sites and affinities

    • Methodology: Similar to approaches used for other transporters, using tools like AutoDock with defined grid parameters around predicted binding sites

These techniques provide complementary information about binding specificity, affinity, and the structural changes that occur during substrate recognition.

How can electrophoretic mobility shift assays (EMSA) be used to study regulatory aspects of AmiC?

While AmiC in S. pneumoniae primarily functions as a transmembrane component of the transport system, studying its regulation requires approaches like EMSA:

Methodological Protocol:

  • Probe Preparation:

    • Design overlapping primers covering approximately 150-180 bp of the predicted promoter region of the ami operon

    • Radiolabel with [α32P]dCTP

  • Binding Reaction:

    • Mix purified regulatory proteins (potentially involved in ami operon regulation) with labeled DNA

    • Include specific competitors to confirm binding specificity

    • Add potential effector molecules like acetamide to assess regulation

  • Analysis:

    • Run on non-denaturing polyacrylamide gel

    • Analyze band shifts to identify protein-DNA interactions

    • Use supershift assays with specific antibodies to confirm protein identity

  • Motif Identification:

    • Use tools like MEME (Multiple Em for Motif Elicitation) to identify binding motifs

This approach has successfully identified regulatory interactions in the acetamidase operon of M. smegmatis, revealing how AmiC (albeit with different function in this organism) interacts with regulatory regions .

How does the function of AmiC differ between encapsulated and nonencapsulated S. pneumoniae strains?

The function of oligopeptide transporters may vary between encapsulated and nonencapsulated S. pneumoniae:

  • Substrate-Binding Protein Variation:

    • Nonencapsulated S. pneumoniae (NESp) specifically possess AliC and AliD substrate-binding proteins that serve as indirect gene regulators

    • These proteins bind unique oligopeptide sequences compared to AmiA, suggesting adaptation to different nutritional environments

  • Functional Significance:

    • Research demonstrates that oligopeptide transporters are important for infections by both encapsulated and nonencapsulated S. pneumoniae

    • The capsule-negative strains potentially rely more heavily on alternative virulence factors, possibly including modified Ami system functions

  • Interaction with Surface Structures:

    • Studies show that capsule and surface proteins have additive effects on pneumococcal resistance to antimicrobial peptides

    • This suggests potential functional interactions between the capsule, surface proteins, and membrane transport systems

Research Gap and Future Direction:
Comparative studies directly examining AmiC function in isogenic encapsulated and nonencapsulated strains would help elucidate these differences.

What computational approaches can advance our understanding of AmiC transport mechanisms?

Computational methods offer powerful tools for studying transport mechanisms:

  • Molecular Dynamics Simulations:

    • All-atom simulations to model conformational changes during transport cycle

    • Coarse-grained simulations for longer timescale events

    • Methodology: Similar to approaches used for PepTSo, using Markov State Models (MSMs) and Transition Path Theory (TPT)

  • Free Energy Calculations:

    • Potential of Mean Force (PMF) calculations to determine energy barriers

    • Methodology: Umbrella sampling along predefined reaction coordinates to map the energetics of substrate transport

  • Machine Learning Approaches:

    • Training models to predict substrate specificity based on sequence features

    • Identifying conserved residues critical for function through multiple sequence alignments

These computational approaches have successfully revealed insights into other transporters, showing for example that substrate binding can lower free energy barriers associated with transition to transport-competent states .

How might AmiC be exploited as a target for novel antimicrobial therapies?

The essential role of the Ami permease system in pneumococcal nutrition and virulence makes it a potential therapeutic target:

  • Inhibitor Design Strategies:

    • Substrate analogs that competitively inhibit oligopeptide binding

    • Allosteric inhibitors that prevent conformational changes required for transport

    • ATPase inhibitors that block the energy supply for transport

  • Pharmacophore Development:

    • Identification of critical binding features through computational modeling

    • Structure-based design using homology models of AmiC

    • Fragment-based approaches to discover novel binding scaffolds

  • Delivery Considerations:

    • Lipophilicity requirements for penetrating the bacterial membrane

    • Stability against pneumococcal degradative enzymes

    • Specificity to avoid targeting human peptide transporters

  • Adjuvant Potential:

    • AmiC inhibitors could potentially sensitize S. pneumoniae to existing antibiotics

    • Combining with anti-PspA approaches may have synergistic effects, as PspA has been shown to protect against antimicrobial peptides

Experimental Validation Table:

ApproachAdvantagesChallengesValidation Method
Substrate analogsTarget specificityCompetition with natural substratesGrowth inhibition assays
Allosteric inhibitorsLower resistance potentialComplex structure-activity relationshipsConformational change assays
ATPase inhibitorsPotential broad-spectrum activitySelectivity over host ATP-dependent enzymesATPase activity assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.