Recombinant Streptococcus pneumoniae Oligopeptide transport system permease protein AmiD (amiD)

Shipped with Ice Packs
In Stock

Description

Introduction to Streptococcus pneumoniae Oligopeptide Transport System Permease Protein AmiD

Streptococcus pneumoniae, commonly known as pneumococcus, is a gram-positive bacterium that represents a significant human pathogen responsible for various infections including pneumonia, meningitis, and septicemia. The bacterial cell surface contains multiple ATP-binding cassette (ABC) transporters that critically influence nasopharyngeal colonization and invasive infections . Among these transport systems, the Ami-AliA/AliB oligopeptide permease holds particular importance as it facilitates nutrient uptake and potentially contributes to signaling pathways .

The Ami-AliA/AliB permease system consists of several components: three oligopeptide-binding lipoproteins (AmiA, AliA, and AliB), two transmembrane proteins (AmiC and AmiD) that form the transport channel, and two ATPases (AmiE and AmiF) that provide energy for substrate translocation . Within this complex, AmiD functions as one of the crucial transmembrane proteins that forms the pore for oligopeptide transport across the cell membrane.

Expression Systems

Recombinant Streptococcus pneumoniae AmiD protein is primarily produced using Escherichia coli expression systems . The protein is typically expressed with an N-terminal histidine (His) tag to facilitate purification and downstream applications . The recombinant expression construct contains the full-length sequence (amino acids 1-308) of the AmiD protein .

Table 1: Common Expression Systems for Recombinant AmiD Production

Expression HostTagProtein LengthApplicationsReferences
E. coliHisFull length (1-308 aa)ELISA, WB, Research
YeastHisFull length (1-308 aa)Vaccine development
BaculovirusHisFull length (1-308 aa)Structural studies
Mammalian cellsHisFull length (1-308 aa)Functional studies

Role in the Ami-AliA/AliB Permease System

The AmiD protein functions as an integral transmembrane component of the Ami-AliA/AliB oligopeptide permease system . This ABC transporter is involved in the uptake of oligopeptides, which serve as important nutrient sources for Streptococcus pneumoniae . The Ami system includes three oligopeptide-binding lipoproteins (AmiA, AliA, and AliB), the transmembrane proteins AmiC and AmiD that form the transport channel, and two ATPases (AmiE and AmiF) that provide energy for substrate translocation .

Within this system, AmiD works in conjunction with AmiC to form a channel through which oligopeptides can pass across the bacterial membrane . The oligopeptide-binding proteins capture peptides from the extracellular environment and deliver them to the transmembrane channel formed by AmiC and AmiD, with transport driven by ATP hydrolysis catalyzed by AmiE and AmiF .

Nutritional Significance

Streptococcus pneumoniae is auxotrophic for certain amino acids, making oligopeptide uptake via the Ami transport system indispensable in host compartments lacking free amino acids . The AmiD protein, as part of this transport system, plays a crucial role in bacterial nutrition by facilitating the import of oligopeptides that can be subsequently hydrolyzed into amino acids for bacterial metabolism .

Studies involving mutants of the Ami system components have demonstrated the nutritional importance of this transport system. For instance, mutations in the genes encoding AmiC and AmiD have been shown to affect bacterial growth in media where oligopeptides represent the primary nitrogen source .

Potential Role in Adhesion

Some studies suggest that components of peptide permeases, including the Ami system, may modulate pneumococcal adherence to epithelial and endothelial cells . Mutations in the ami locus resulted in an inability to recognize specific glycoconjugate receptors present on resting lung cells and endothelial cells . This suggests that the Ami permease system, of which AmiD is a component, might influence bacterial adhesion either by acting directly as adhesins or by modulating the expression of adhesins on the pneumococcal surface during the initial stages of colonization .

Vaccine Development

Table 2: Research Applications of Recombinant AmiD

ApplicationDescriptionRelevant Findings
Structural AnalysisInvestigating protein structure and membrane integrationContributes to understanding of ABC transporter architecture
Functional StudiesExamining role in oligopeptide transportEssential component of functional Ami permease system
Vaccine ResearchEvaluating potential as vaccine antigenUnder investigation as potential vaccine target
Antimicrobial DevelopmentIdentifying inhibitors of AmiD functionPotential target for novel antimicrobials

Diagnostic Applications

Recombinant AmiD protein can also be used in diagnostic applications, particularly for the development of immunoassays for the detection of Streptococcus pneumoniae or anti-pneumococcal antibodies . The purified protein can serve as a capture antigen in ELISA or other immunological assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice shipping is preferred, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
amiD; spr1705; Oligopeptide transport system permease protein AmiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
amiD
Target Protein Sequence
MSTIDKEKFQFVKRDDFASETIDAPAYSYWKSVFKQFMKKKSTVVMLGILVAIILISFIY PMFSKFDFNDVSKVNDFSVRYIKPNAEHWFGTDSNGKSLFDGVWFGARNSILISVIATVI NLVIGVFVGGIWGISKSVDRVMMEVYNVISNIPPLLIVIVLTYSIGAGFWNLIFAMSVTT WIGIAFMIRVQILRYRDLEYNLASRTLGTPTLKIVAKNIMPQLVSVIVTTMTQMLPSFIS YEAFLSFFGLGLPITVPSLGRLISDYSQNVTTNAYLFWIPLTTLVLVSLSLFVVGQNLAD ASDPRTHR
Uniprot No.

Target Background

Function
As part of the binding-protein-dependent transport system for oligopeptides, this protein is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: spr:spr1705

STRING: 171101.spr1705

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the AmiD protein and what is its function in Streptococcus pneumoniae?

AmiD is a critical component of the oligopeptide transport system in Streptococcus pneumoniae. It functions as a permease protein within the binding-protein-dependent transport system for oligopeptides, where it is primarily responsible for the translocation of substrate peptides across the bacterial membrane . As part of the ATP-binding cassette (ABC) transporter superfamily, AmiD works in conjunction with other components to facilitate the transport of oligopeptides into the bacterial cell . The full amino acid sequence of AmiD consists of 308 amino acids, and it is also known by the ordered locus name spr1705 .

How does the oligopeptide transport system function in Streptococcus pneumoniae?

The oligopeptide transport system in Streptococcus pneumoniae, also known as the Ami system, belongs to the ATP-binding cassette (ABC) transporter superfamily. This transport system is composed of five essential subunits:

  • An extracellular oligopeptide-binding protein (such as AmiA) that specifically captures substrate peptides

  • Two transmembrane proteins (including AmiD) that form the pore through which peptides are transported

  • Two membrane-bound cytoplasmic ATP-binding proteins that provide the energy required for peptide translocation through ATP hydrolysis

The system serves dual functions in S. pneumoniae: a nutritional role, providing the bacterium with essential peptides as amino acid sources, and a sensing role, allowing the bacterium to detect environmental signals and communicate with neighboring bacterial species .

What are the optimal methods for expressing recombinant AmiD protein?

For optimal expression of recombinant AmiD protein, researchers typically utilize one of several expression systems, with E. coli being the most common for initial studies. The following methodological approach is recommended:

  • Vector Selection: Choose an expression vector with an appropriate promoter (T7 is commonly used) and a fusion tag (His-tag is preferred for ease of purification)

  • Expression Conditions:

    • Grow transformed E. coli to mid-log phase (OD600 of 0.6-0.8)

    • Induce protein expression with IPTG (0.5-1.0 mM)

    • Incubate at lower temperatures (16-25°C) for 4-16 hours to promote proper folding

  • Alternative Expression Systems: For more complex studies requiring proper folding and post-translational modifications, consider yeast, baculovirus, or mammalian cell expression systems

When working with membrane proteins like AmiD, it's crucial to optimize solubilization conditions using appropriate detergents to maintain the protein's native conformation during purification.

How can I purify recombinant AmiD protein while maintaining its functional integrity?

Purifying membrane proteins like AmiD requires special considerations to maintain structural and functional integrity:

  • Cell Lysis: Use gentle mechanical disruption in the presence of protease inhibitors

  • Membrane Fraction Isolation: Separate membrane fractions through differential centrifugation

  • Solubilization: Use mild detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane fraction

  • Affinity Chromatography: If using His-tagged protein, use Ni-NTA columns

  • Buffer Optimization: Include appropriate detergents in all buffers (typically at concentrations just above CMC)

  • Storage: Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

For functional studies, it's critical to verify that the purified protein maintains its ability to bind and transport relevant peptide substrates.

What assays can be used to evaluate AmiD peptide-binding activity?

Several methods can be employed to assess the peptide-binding activity of recombinant AmiD:

  • Peptide Capture Assays: Incubate purified recombinant AmiD with potential peptide ligands, then identify bound peptides through:

    • Liquid chromatography-mass spectrometry (LC-MS)

    • Manual de novo peptide sequencing with MS/MS spectra analysis

  • Binding Affinity Measurements:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence anisotropy with labeled peptides

  • Functional Transport Assays:

    • Liposome reconstitution systems with radiolabeled or fluorescently-labeled peptides

    • Whole-cell transport assays measuring peptide uptake

These methods provide complementary information about peptide binding specificity, affinity, and transport functionality.

How does AmiD contribute to interspecies bacterial communication and environmental sensing?

The role of AmiD in the Ami-AliA/AliB oligopeptide transport system extends beyond simple nutrient acquisition to sophisticated environmental sensing and interspecies communication:

  • Peptide Recognition: As part of this system, AmiD helps transport specific peptides that originate from other bacterial species, particularly from the class Gammaproteobacteria that commonly colonize the nasopharynx and nostrils

  • Signal Transduction: Upon peptide internalization, signal transduction pathways can be activated, allowing S. pneumoniae to:

    • Detect the presence of competing bacteria

    • Adapt gene expression in response to environmental conditions

    • Modulate virulence factor production based on microbial community composition

  • Competence Regulation: The Ami transporter system is essential for controlling the triggering of competence state through regulation of comX transcription, thereby influencing horizontal gene transfer capabilities

Research methods to study these functions include:

  • Transcriptomics to measure changes in gene expression following peptide exposure

  • Bacterial co-culture systems to observe interspecies effects

  • In vivo colonization models to assess ecological impacts

What is the relationship between AmiD function and Streptococcus pneumoniae pathogenesis?

The oligopeptide transport system, including AmiD, plays significant roles in S. pneumoniae pathogenesis through several mechanisms:

  • Nutritional Adaptation: By importing peptides, AmiD helps S. pneumoniae acquire essential amino acids in nutrient-limited host environments

  • Host-Pathogen Interactions: The transport system may recognize and respond to host-derived peptides, potentially modulating virulence expression

  • Biofilm Formation: Peptide sensing via this transport system influences biofilm development, a critical virulence determinant

  • Competence Regulation: By controlling competence through comX regulation, the Ami system affects genetic adaptability, potentially including the acquisition of antibiotic resistance genes

Experimental approaches to study these relationships include:

  • Mutant strains with deleted or modified amiD genes

  • Animal infection models comparing wild-type and mutant strains

  • Transcriptome and proteome analysis under various conditions mimicking the host environment

How can contradictions in experimental data regarding AmiD function be reconciled and used to generate novel hypotheses?

When facing contradictory results in AmiD research, applying structured approaches can transform these contradictions into valuable research opportunities:

  • Identification of Contradictions:

    • Different reported binding specificities for AmiD across studies

    • Varied phenotypic effects of amiD mutations

    • Inconsistent impacts on competence regulation

  • Analytical Framework:

    • Examine differences in experimental conditions (strain backgrounds, growth media, environmental factors)

    • Consider confirmation bias in data interpretation

    • Evaluate potential for multiple functional modes of AmiD in different contexts

  • Hypothesis Generation:

    • Propose condition-specific functions for AmiD

    • Consider potential protein interactions that modify function

    • Explore regulatory networks that could explain contextual differences

As highlighted in research on scientific contradictions, "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" . This perspective encourages researchers to view contradictory findings as opportunities rather than failures.

What protein-peptide docking methods are most effective for studying AmiD-peptide interactions?

For studying AmiD-peptide interactions computationally, several docking approaches can be employed:

  • Molecular Docking Software Options:

    • AutoDock Vina: Effective for initial screening of potential peptide binding modes

    • HADDOCK: Particularly useful when experimental constraints are available

    • Rosetta FlexPepDock: Specialized for peptide-protein docking with flexible peptide backbones

  • Methodological Workflow:

    • Generate a reliable structural model of AmiD (homology modeling may be required)

    • Prepare peptide structures in multiple conformations

    • Perform blind docking to identify potential binding sites

    • Refine with focused docking at identified sites

    • Validate with molecular dynamics simulations

  • Considerations for Membrane Proteins:

    • Include membrane environment effects using implicit membrane models

    • Consider the orientation of the protein within the membrane

    • Focus on accessible regions of the protein for peptide binding

When analyzing results, researchers should cross-validate computational predictions with experimental binding data from techniques like those described in question 2.3.

How can researchers effectively study the roles of AmiD in bacterial communities and mixed cultures?

Studying AmiD function in complex bacterial communities requires specialized approaches:

  • Co-Culture Systems:

    • Develop defined mixed cultures of S. pneumoniae with relevant Gammaproteobacteria

    • Use fluorescently-labeled strains to track population dynamics

    • Employ transwell systems to distinguish contact-dependent from soluble signal effects

  • Microbiome Analysis:

    • Compare wild-type and amiD mutant effects on nasopharyngeal microbiome composition

    • Use 16S rRNA sequencing or metagenomic approaches to analyze community changes

    • Employ metabolomics to identify altered metabolic exchanges

  • Advanced Imaging Techniques:

    • Fluorescence in situ hybridization (FISH) to visualize spatial relationships

    • Time-lapse microscopy to track dynamic interactions

    • Super-resolution microscopy to visualize protein localization in mixed communities

  • Single-Cell Approaches:

    • Single-cell RNA-seq to identify transcriptional responses to community interactions

    • Cell sorting coupled with downstream analysis to isolate specific interaction states

These methods can reveal how AmiD contributes to S. pneumoniae's ability to sense and respond to its microbial environment.

What bioinformatic approaches are valuable for analyzing AmiD homologs across bacterial species?

Comprehensive bioinformatic analysis of AmiD homologs provides valuable evolutionary and functional insights:

  • Sequence Analysis Pipeline:

    • BLAST and HMMer searches to identify homologs across bacterial genomes

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic tree construction using Maximum Likelihood or Bayesian methods

    • Identification of conserved motifs and domains using MEME or PROSITE

  • Structural Analysis:

    • Homology modeling of diverse homologs using tools like I-TASSER or SWISS-MODEL

    • Structural alignment to identify conserved binding pockets

    • Molecular dynamics simulations to compare conformational flexibility

  • Genomic Context Analysis:

    • Examination of operon structures across species

    • Identification of co-evolved genes using methods like mutual information analysis

    • Comparative analysis of regulatory regions

The resulting data can reveal evolutionary patterns, functional constraints, and potential species-specific adaptations in AmiD function.

What statistical approaches are recommended for analyzing contradictory experimental results related to AmiD function?

When confronted with contradictory results in AmiD research, robust statistical frameworks can help navigate inconsistencies:

Research Table: Peptide Binding Specificities in the Ami-AliA/AliB System

ProteinPeptide SequenceMatching Protein SourcePotential FunctionReference
AmiAAKTIKITQTR50S ribosomal subunit protein L30Detection of Gammaproteobacteria
AliAFNEMQPIVDRQ30S ribosomal protein S20Detection of Gammaproteobacteria
AliBAIQSEKARKHN30S ribosomal protein S20Detection of Gammaproteobacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.