Recombinant Streptococcus pneumoniae Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Streptococcal Species

CrcB1 homologs are implicated in fluoride resistance across oral and pathogenic Streptococcus species. In S. sanguinis, crcB1 and crcB2 act redundantly to enable growth under fluoride stress, with single mutants showing impaired survival at 75 ppm NaF . Similar mechanisms may operate in S. pneumoniae, though direct evidence remains limited.

Functional Comparison Across Species

SpeciesRole in Fluoride ResistanceGene StructureReference
S. sanguinisCritical for NaF toleranceTandem crcB1/crcB2
S. pneumoniaeCore genome presencecrcB1 (single copy)
E. coliFluoride effluxcrcB (127 aa)

Recombinant Production and Applications

Recombinant crcB1 proteins are primarily derived from non-pneumoniae species (e.g., Symbiobacterium thermophilum), expressed in E. coli with N-terminal His tags . These constructs enable structural and biochemical studies but lack direct relevance to S. pneumoniae pathobiology.

A. Core Genome Role in S. pneumoniae

CrcB1 is part of the S. pneumoniae core genome, encoding 28 hypothetical proteins (HPs) with potential roles in transcription, translation, and virulence . Bioinformatics predicts:

  • Subcellular Localization: Cytoplasmic or membrane-associated.

  • Interactions: Limited data, but HPs often form networks with regulators (e.g., RocS) .

Fluoride Resistance Mechanisms

In S. sanguinis, crcB1 and crcB2 function as fluoride channels, with complementation restoring NaF tolerance . While S. pneumoniae lacks crcB2, its crcB1 may similarly mediate ion efflux.

Therapeutic and Vaccine Potential

CrcB1’s conservation across Streptococcus species makes it a candidate for broad-spectrum antimicrobial targets. Recombinant proteins (e.g., His-tagged variants) are used in structural studies and vaccine development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
crcB1; spr1172; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
crcB1
Target Protein Sequence
MVIVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAIL ATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLILTYLGGLVAIFLGILL
Uniprot No.

Target Background

Function

Important Function: CrcB1 plays a crucial role in reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: spr:spr1172

STRING: 171101.spr1172

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Streptococcus pneumoniae CrcB homolog 1 (crcB1) protein?

CrcB homolog 1 (crcB1) is a membrane protein in S. pneumoniae that belongs to the CrcB protein family. These proteins are generally involved in fluoride ion transport and resistance mechanisms. In S. pneumoniae, CrcB1 is one of several proteins involved in maintaining ion homeostasis, which is critical for bacterial survival and pathogenicity. The protein's structure includes transmembrane domains consistent with its role in membrane transport processes.

What genomic techniques are available for studying crcB1 in S. pneumoniae?

Genomic analysis of crcB1 can be performed using several approaches:

  • Whole Genome Sequencing (WGS): As demonstrated in studies of S. pneumoniae recombination, WGS can map genetic transfers between strains with high resolution using SNP analysis .

  • PCR amplification and Sanger sequencing: For targeted analysis of the crcB1 gene region.

  • Comparative genomics: Analyzing crcB1 across different S. pneumoniae strains to identify variations that might correlate with phenotypic differences.

  • Transcriptomic analysis: RNA-seq can be used to determine expression patterns of crcB1 under various environmental conditions.

When designing primers for crcB1 amplification, researchers should account for sequence variations across strains and optimize annealing temperatures to ensure specificity.

What expression systems are most effective for producing recombinant S. pneumoniae crcB1?

The optimal expression system depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, economical, rapid growthPotential misfolding of membrane proteinsInitial functional studies
E. coli C41/C43Specialized for membrane proteinsLower yields than standard strainsStructural studies requiring proper folding
Bacillus subtilisGram-positive background, better foldingMore complex genetic manipulationFunctional studies needing native-like folding
Cell-free systemsAvoids toxicity issues, rapidExpensive, lower yieldToxic proteins or rapid screening
Mammalian cellsPost-translational modificationsExpensive, time-consumingInteraction studies with host proteins

For membrane proteins like crcB1, consider using specialized E. coli strains designed for membrane protein expression or detergent solubilization strategies during purification.

What optimization strategies can improve yield and solubility of recombinant crcB1?

Based on principles of recombinant protein expression:

  • Temperature optimization: Lower temperatures (16-25°C) often improve folding of membrane proteins.

  • Induction conditions: Test various IPTG concentrations (0.1-1.0 mM) and induction times.

  • Fusion tags selection:

    • SUMO tag can enhance solubility

    • His-tag for purification

    • MBP (maltose-binding protein) for improved solubility and expression

  • Detergent screening: Systematically test detergents like DDM, LDAO, or C12E8 for solubilization.

  • Co-expression with chaperones: DnaK/DnaJ/GrpE or GroEL/GroES systems can improve folding.

Experimental design approaches with factorial designs can efficiently identify optimal expression conditions by testing multiple variables simultaneously .

What purification strategies are most effective for S. pneumoniae crcB1?

A multi-step purification protocol is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

  • Intermediate purification: Ion exchange chromatography based on predicted pI of crcB1

  • Polishing: Size exclusion chromatography to remove aggregates and achieve high purity

For membrane proteins like crcB1, maintain appropriate detergent concentrations above critical micelle concentration (CMC) throughout purification. Consider using fluorescence-detection size exclusion chromatography (FSEC) to assess protein quality and monodispersity during protocol development.

How can homologous recombination techniques be applied to study crcB1 in S. pneumoniae?

Homologous recombination in S. pneumoniae can be leveraged for genetic manipulation of crcB1:

  • Gene knockout/replacement: Create crcB1 mutants through homologous recombination using targeted DNA constructs.

  • Environment considerations: Cell-to-cell contact greatly enhances recombination efficiency in S. pneumoniae compared to purified DNA approaches .

  • Optimization strategies:

    • Filter assemblage methods yield mean recombination event sizes of ~4051 bp versus 1815 bp with saturating DNA

    • Biofilm co-culture environments produce similar large recombination events (~3938 bp)

    • Up to 5.8% of the genome can be transferred in a single experiment

Design gene targeting constructs with homology arms of at least 500-1000 bp for efficient recombination, and consider using biofilm or filter assemblage conditions for maximum transfer efficiency.

What controls should be included in crcB1 functional assays?

Robust functional assays require comprehensive controls:

  • Positive controls:

    • Known fluoride transporters (e.g., E. coli CrcB)

    • Positive ion transport indicators with known response profiles

  • Negative controls:

    • Empty vector/expression system

    • Inactive mutant (e.g., site-directed mutagenesis of conserved residues)

    • Non-related membrane protein of similar size

  • Technical controls:

    • Buffer-only samples for background correction

    • Detergent-only samples to control for detergent effects on assays

    • Tests at multiple protein concentrations to establish dose-response

  • Validation controls:

    • Alternative assay methodologies to confirm findings

    • Complementation of knockout strains to verify phenotype rescue

How can researchers differentiate between direct and indirect effects of crcB1 in experimental settings?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Direct binding assays:

    • Surface plasmon resonance (SPR) to measure direct interactions

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Microscale thermophoresis for interaction analysis in solution

  • Specificity testing:

    • Competition assays with known ligands

    • Structure-based mutagenesis of putative binding sites

    • Cross-linking followed by mass spectrometry to identify direct binding sites

  • Downstream effect analysis:

    • Time-course studies to establish temporal relationships

    • Conditional expression systems to control timing of crcB1 expression

    • Metabolomic profiling to identify cascading effects

  • Reconstitution studies:

    • Purified components in vitro to demonstrate sufficiency

    • Liposome reconstitution for transport proteins like crcB1

What approaches can be used to investigate the role of crcB1 in S. pneumoniae pathogenesis?

Investigating pathogenesis contributions requires multi-faceted approaches:

  • Animal infection models:

    • Compare virulence of wild-type versus crcB1 deletion mutants

    • Competitive index assays with mixed infections

    • Tissue-specific bacterial burden quantification

    • Complementation studies to confirm phenotypes

  • Host-pathogen interaction studies:

    • Adherence and invasion assays with human cell lines

    • Cytokine response measurements

    • Neutrophil killing resistance assays

    • Biofilm formation capacity on relevant tissues

  • Transcriptomic and proteomic analyses:

    • RNA-seq of host and pathogen during infection

    • Proteomics to identify regulated pathways

    • Dual RNA-seq for simultaneous host-pathogen transcriptomics

  • In vivo imaging:

    • Bioluminescent or fluorescent reporters linked to crcB1 expression

    • Real-time monitoring of infection progression

How can researchers address data contradictions in crcB1 functional studies?

Resolving experimental contradictions requires systematic troubleshooting:

  • Methodological validation:

    • Reproduce experiments using standardized protocols

    • Test multiple experimental conditions and timepoints

    • Verify reagent quality and specificity

    • Employ alternative detection methods

  • Strain variation analysis:

    • Sequence verification of strains used across studies

    • Testing multiple clinical and laboratory strains

    • Consider serotype differences that might affect results

  • Environmental factor assessment:

    • Standardize growth conditions (medium, temperature, oxygen levels)

    • Test effects of biofilm versus planktonic growth

    • Examine cell density effects on phenotypes

  • Statistical robustness:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests

    • Perform power analysis to ensure adequate sample sizes

    • Consider meta-analysis approaches for combining datasets

What cutting-edge techniques can advance understanding of crcB1 structure-function relationships?

Emerging technologies offer new insights into crcB1:

  • Structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures

    • X-ray crystallography with lipidic cubic phase crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • AlphaFold2 or RoseTTAFold prediction with experimental validation

  • Advanced functional characterization:

    • Single-molecule FRET to observe conformational changes

    • Nanodiscs for native-like membrane environment studies

    • Patch-clamp electrophysiology for ion channel properties

    • Fluoride-selective electrodes for transport activity

  • Genetic approaches:

    • CRISPR interference for conditional repression

    • Deep mutational scanning to map functional regions

    • Suppressor mutation screens to identify genetic interactions

    • Recombination mapping using whole genome sequencing

  • Systems biology integration:

    • Metabolic flux analysis in presence/absence of crcB1

    • Protein-protein interaction networks using BioID or APEX proximity labeling

    • Multi-omics data integration to place crcB1 in cellular pathways

What strategies can overcome expression difficulties with recombinant crcB1?

When facing expression challenges:

  • Codon optimization: Adjust codon usage to match expression host

  • Toxicity management:

    • Use tight promoter control systems

    • Test glucose repression for leaky expression

    • Consider cell-free expression systems

  • Expression construct design:

    • Test truncated constructs removing problematic domains

    • Try different fusion partners (SUMO, MBP, TrxA)

    • Optimize ribosome binding sites for translation efficiency

  • Host strain selection:

    • Screen multiple expression strains

    • Test strains with additional rare tRNAs

    • Use strains with reduced protease activity

How can researchers validate antibodies for studying native crcB1 protein?

Antibody validation requires comprehensive testing:

  • Specificity controls:

    • Western blot comparison of wild-type versus crcB1 knockout strains

    • Peptide competition assays

    • Testing on recombinant purified protein

    • Cross-reactivity assessment with related proteins

  • Application-specific validation:

    • For immunoprecipitation: Pull-down efficiency quantification

    • For immunofluorescence: Subcellular localization confirmation

    • For ChIP applications: Known binding site recovery tests

  • Reproducibility assessment:

    • Test multiple antibody lots

    • Compare monoclonal versus polyclonal antibodies

    • Validate across different experimental conditions

  • Alternative detection methods:

    • Epitope tagging approaches as complementary methods

    • Mass spectrometry verification of immunoprecipitated proteins

What are the best approaches to study crcB1 in the context of bacterial communities?

Community-level studies require specialized approaches:

  • Biofilm models:

    • Static biofilm assays (crystal violet)

    • Flow cell systems for dynamic biofilms

    • Confocal microscopy with fluorescent strains

    • Filter assemblage methods that facilitate cell-to-cell contact

  • Mixed culture experiments:

    • Co-culture with relevant species found in pneumococcal niches

    • Metagenomic analysis of community changes

    • Dual-species biofilms to study interspecies interactions

  • Spatial organization assessment:

    • Fluorescence in situ hybridization (FISH)

    • Spatial transcriptomics in biofilm structures

    • 3D biofilm imaging with species-specific markers

  • Horizontal gene transfer analysis:

    • Monitor recombination frequencies under various conditions

    • Assess impact of crcB1 variants on genetic exchange

    • Trace acquisition patterns in clinical isolates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.