Recombinant Streptococcus pneumoniae Sensor protein CiaH (ciaH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ciaH; spr0708; Sensor protein CiaH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Target Names
ciaH
Target Protein Sequence
MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYTSVDDKLHGLSENPQA VIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKDFTQLLSGNRFLGLDKI KLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKYAAVLINTSQLEQASQKH EQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVENASHELRTPLAVLQNRLE TLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRDDGIKPELAEVPTSFFNTTF TNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISATD RNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDALKGTVTV KDNKPKGTIFEVKIAIQTPSKKKK
Uniprot No.

Target Background

Function
CiaH is a member of the two-component regulatory system CiaH/CiaR in *Streptococcus pneumoniae*. It plays a crucial role in early competence regulation and penicillin susceptibility, likely functioning as a kinase to phosphorylate CiaR.
Gene References Into Functions
  1. A hyperactive CiaRH system inhibits competence development through csRNA-mediated post-transcriptional repression of CSP (competence stimulating peptide) production. PMID: 23710838
  2. All mutant ciaH alleles increased CiaR-mediated gene expression beyond wild-type levels. PMID: 21903754
  3. CiaH may function as a kinase or phosphatase, and CiaR appears capable of independent phosphorylation regardless of CiaH. PMID: 21422763
Database Links

KEGG: spr:spr0708

STRING: 171101.spr0708

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CiaH protein in Streptococcus pneumoniae and how is it structured?

CiaH is a histidine protein kinase that functions as a sensor component of the CiaRH two-component signal transduction system in S. pneumoniae. Structurally, CiaH contains an N-terminal external sensor domain and a cytoplasmic kinase domain separated by two membrane-spanning regions . This architecture enables CiaH to detect environmental signals outside the cell and transmit this information to the cytoplasm. The gene encoding CiaH is located adjacent to ciaR with an 8-bp overlap, and together they form an operon . The CiaH-CiaR system was the first of 13 two-component systems identified in S. pneumoniae and has been extensively studied for its role in antibiotic resistance and cellular homeostasis .

How does the CiaH-CiaR signaling pathway function?

The CiaH-CiaR system operates through a classical phosphorelay mechanism. When CiaH detects specific environmental stimuli (such as low calcium concentration), it undergoes autophosphorylation at a conserved histidine residue in its kinase domain . This phosphoryl group is then transferred to an aspartate residue in the DNA-binding response regulator CiaR. Phosphorylated CiaR binds to specific DNA sequences in the promoter regions of target genes, regulating their expression .

Northern blot analysis has demonstrated that in wild-type strains, the ciaR-ciaH genes produce a single mRNA transcript, indicating they constitute an operon . Importantly, the system becomes constitutively activated in strains carrying certain ciaH mutations, leading to altered expression of the CiaR regulon and subsequent phenotypic changes, including increased antibiotic resistance and transformation deficiency .

What methods are used to express recombinant CiaH protein?

Recombinant expression of CiaH can be achieved using standard molecular cloning and protein expression techniques. A successful approach has been documented using the following methodology:

  • PCR amplification of the complete ciaH gene from S. pneumoniae genomic DNA

  • Cloning into a prokaryotic expression vector (e.g., pET42a)

  • Transformation into an expression strain such as E. coli BL21DE3

  • Induction of protein expression under optimized conditions

Using this approach, researchers have achieved expression levels where recombinant CiaH (rCiaH) constitutes approximately 33% of the total bacterial proteins . For functional studies, researchers have used a biotinylated fusion derivative of CiaH that can be purified via interaction with streptavidin-coated magnetic beads .

Table 1: Recombinant CiaH Expression Systems and Yields

Expression SystemVectorHostFusion TagExpression YieldReference
ProkaryoticpET42aE. coli BL21DE3Not specified33% of total protein
ProkaryoticNot specifiedE. coli WM1704Biotin tag (P. shermanii transcarboxylase)Not specified

What role does CiaH play in beta-lactam antibiotic resistance?

CiaH has been extensively studied for its contribution to beta-lactam antibiotic resistance in S. pneumoniae. Mutations in the ciaH gene confer increased resistance to beta-lactam antibiotics, particularly cefotaxime, revealing a novel pathway for resistance development . This resistance mechanism appears to be related to the regulation of genes involved in cell wall biosynthesis and integrity.

Interestingly, experimental evidence indicates that the relationship between CiaH and antibiotic resistance is complex. When CiaH is extracellularly or intracellularly blocked by specific antibodies (CiaH-IgG), penicillin-sensitive or cefotaxime-sensitive strains can develop resistance to these antibiotics . This suggests that under certain conditions, inhibition of CiaH function may actually promote resistance.

Furthermore, a functional CiaRH system is required for the survival of S. pneumoniae strains with altered penicillin-binding proteins (PBPs). Disruption of CiaR in penicillin-resistant mutants with low-affinity PBP2x results in severe growth defects and rapid lysis . This indicates that the CiaRH system plays a crucial compensatory role in maintaining cell wall integrity when PBPs are altered, explaining why cia mutations are rare in clinical isolates of penicillin-resistant pneumococci .

What environmental signals activate the CiaH sensor protein?

Research has identified several environmental signals that activate the CiaH sensor:

  • Calcium concentration: The CiaH-CiaR system is activated when the Ca²⁺ concentration is very low, demonstrating that calcium is a key environmental signal sensed by CiaH .

  • Cell wall stress: CiaH responds to various lysis-inducing conditions, including exposure to cell wall inhibitors such as cycloserine, bacitracin, and vancomycin .

  • Acid stress: Studies in both S. pneumoniae and the related species S. pyogenes have shown that CiaH is involved in acid response, with CiaH knockout strains showing significant growth reduction in acidic conditions .

  • Oxidative stress: The CiaH-CiaR system appears to contribute to oxidative stress tolerance, possibly through regulation of stress response genes such as htrA .

These findings suggest that CiaH functions as a multisensory protein capable of detecting diverse environmental stresses and coordinating appropriate cellular responses through the CiaR regulon.

What is the composition of the CiaR regulon in S. pneumoniae?

Using solid-phase DNA binding assays and microarray analysis, researchers have identified the genes directly regulated by CiaR in S. pneumoniae. The minimal CiaR regulon comprises 18 chromosomal regions containing 26 CiaR target sites . These target loci can be categorized into several functional groups:

Table 2: Components of the CiaR Regulon in S. pneumoniae

Functional CategoryRepresentative Target LociBiological RoleReference
Cell wall metabolismNot specifically namedSynthesis and modification of cell wall polymers
Cell signalingNot specifically namedPeptide pheromone production
Antimicrobial activityNot specifically namedBacteriocin production
Stress responsehtrA-spo0J regionProtein quality control, stress tolerance
Teichoic acid biosynthesisNot specifically namedCell wall component synthesis

This regulon composition explains the pleiotropic phenotypes observed in CiaH mutants, including altered antibiotic sensitivity, growth defects, early lysis tendency, and attenuation of virulence .

How do CiaH mutations affect S. pneumoniae phenotypes?

Mutations in CiaH lead to diverse phenotypic changes in S. pneumoniae. These effects are summarized in the following table:

Table 3: Effects of CiaH/CiaR Mutations on S. pneumoniae Phenotypes

Mutation TypeBeta-lactam ResistanceGenetic CompetenceCell Wall IntegrityGrowth CharacteristicsReference
Activated CiaHIncreasedDeficientEnhancedResistant to lysis inducers
CiaH knockoutDecreasedEnhancedCompromisedHypersusceptible to cell wall inhibitors
CiaR deletion in PBP2x mutantsDecreasedNot reportedSeverely compromisedSevere growth defects, rapid lysis

Of particular interest is the observation that activated CiaH mutants demonstrate high resistance to lysis induced by various cell wall inhibitors and are less susceptible to these drugs . In contrast, CiaH knockout strains are hypersusceptible to cell wall active antibiotics and unable to maintain normal stationary phase growth .

What experimental approaches are used to study CiaH function?

Researchers employ various experimental techniques to investigate CiaH function, as summarized below:

Table 4: Methodological Approaches for Studying CiaH Function

MethodApplicationTechnical DetailsReference
Gene knockoutFunctional analysisInsertion-duplication mutagenesis with spectinomycin resistance marker
Recombinant expressionProtein productionExpression in E. coli using appropriate vectors
DNA binding assaysTarget identificationSolid-phase assay with biotinylated CiaR and microarray analysis
Reporter gene fusionsExpression analysislacZ fusions to monitor CiaR-regulated promoters
Antibody inhibitionProtein function blockingRabbits antisera and IgGs against recombinant CiaH
Northern blotTranscriptional analysisDetection of ciaRH operon expression
Antibiotic susceptibility testingPhenotypic analysisTesting resistance to various cell wall inhibitors

These complementary approaches allow for comprehensive characterization of CiaH function at molecular, cellular, and phenotypic levels.

What is the relationship between CiaH, HtrA expression, and stress tolerance?

The relationship between CiaH and the serine protease HtrA is an important aspect of stress tolerance in S. pneumoniae. In pneumococcal strains, deletion of ciaR (the response regulator gene) makes bacteria more sensitive to oxidative stress, and this has been attributed to diminished expression of HtrA .

Experimental evidence suggests that HtrA expression is regulated by the CiaH-CiaR system and contributes to oxidative stress tolerance. In a study with S. pyogenes, a spy1236 (ciaH) knockout strain showed increased sensitivity to hydrogen peroxide, but this sensitivity could be partially reversed by introducing a plasmid expressing htrA . This indicates that HtrA is a downstream effector in the CiaH-mediated stress response.

Interestingly, while the regulatory relationship between CiaH and HtrA appears conserved in S. pneumoniae, the expression pattern differs in S. pyogenes. In S. pyogenes, htrA expression was not decreased in CiaH-null mutants compared to wild-type strains , suggesting species-specific differences in the regulatory network.

What challenges exist in purifying functional recombinant CiaH protein?

Purification of functional recombinant CiaH presents several technical challenges:

  • As a membrane-spanning protein with both periplasmic and cytoplasmic domains, CiaH can be difficult to express in its properly folded, native conformation.

  • The hydrophobic transmembrane regions may cause aggregation during expression and purification.

  • Maintaining the correct orientation and membrane insertion is challenging in recombinant systems.

How can the activity of recombinant CiaH be assessed in vitro?

Assessment of recombinant CiaH activity requires measurement of its autophosphorylation and phosphotransfer capabilities. While specific protocols for CiaH are not detailed in the search results, standard approaches for histidine kinases would include:

  • In vitro autophosphorylation assays using [γ-³²P]ATP

  • Phosphotransfer assays to detect phosphorylation of the cognate response regulator CiaR

  • Binding studies to identify activating ligands (such as calcium)

For functional studies, researchers have employed indirect approaches such as antibody blocking experiments. When CiaH was extracellularly or intracellularly blocked by specific antibodies, changes in antibiotic resistance patterns were observed, providing evidence of CiaH function .

What genetic tools are available for manipulating the ciaH gene in S. pneumoniae?

Several genetic approaches have been employed to study CiaH function through manipulation of the ciaH gene:

  • Gene knockout: Insertion-duplication mutagenesis using antibiotic resistance markers (e.g., spectinomycin resistance gene aad9) has been used to disrupt ciaH .

  • Reporter gene fusions: The lacZ reporter gene has been fused to CiaR-regulated promoters to monitor the activity of the CiaH-CiaR system .

  • Site-directed mutagenesis: This approach can be used to introduce specific mutations in ciaH to study structure-function relationships, although details are not explicitly provided in the search results.

  • Expression systems: Plasmid-based systems for expressing wild-type or mutant versions of ciaH can be used for complementation studies .

While not explicitly mentioned in the search results, modern genome editing technologies such as CRISPR-Cas9 would also be applicable for precise manipulation of the ciaH gene in S. pneumoniae.

How does CiaH function vary across different streptococcal species?

Comparative studies suggest both conservation and divergence of CiaH function across streptococcal species:

  • In S. pneumoniae, deletion of ciaR leads to reduced expression of HtrA and increased sensitivity to oxidative stress .

  • In S. pyogenes, expression of htrA was not decreased in CiaH-null mutants compared to wild-type strains, suggesting different regulatory mechanisms .

These findings indicate that while the core function of CiaH as a stress sensor is conserved across streptococcal species, the specific regulatory networks and downstream effectors may have evolved differently to adapt to distinct ecological niches.

How does CiaH interact with other two-component systems in S. pneumoniae?

  • Competence regulation: The CiaH-CiaR system interferes with the development of genetic competence, which is controlled by the ComDE two-component system . The exact molecular mechanism of this cross-talk remains unclear.

  • Cell wall homeostasis: CiaH-CiaR appears to function in concert with penicillin-binding proteins (PBPs) to maintain cell wall integrity. Disruption of CiaR in strains with altered PBP2x results in severe growth defects, suggesting compensatory interactions between these systems .

  • Teichoic acid synthesis: CiaR null mutants are able to grow in choline-deprived medium, suggesting regulatory connections between the CiaH-CiaR system and pathways involved in teichoic acid synthesis .

Further research is needed to fully characterize the interplay between CiaH-CiaR and other regulatory networks in S. pneumoniae.

What are the priorities for further characterization of CiaH function?

Based on current knowledge gaps identified in the literature, several research priorities emerge for further characterization of CiaH:

  • Structural studies: Determining the three-dimensional structure of CiaH, particularly its sensor domain, would provide insights into the molecular mechanism of signal perception.

  • Signal identification: While calcium has been identified as one signal, comprehensive characterization of all environmental cues detected by CiaH is needed.

  • Phosphotransfer dynamics: Detailed biochemical analysis of the phosphotransfer between CiaH and CiaR under different conditions would enhance understanding of signaling kinetics.

  • Regulon mapping: Further refinement of the CiaR regulon across different growth conditions and genetic backgrounds would clarify its role in pneumococcal physiology.

  • Therapeutic targeting: Exploring CiaH as a potential drug target for novel antimicrobial strategies that could sensitize resistant pneumococci to existing antibiotics.

How might CiaH be exploited as a target for novel antimicrobial strategies?

The central role of CiaH in antibiotic resistance and cell wall homeostasis makes it a promising target for novel antimicrobial strategies:

  • Adjuvant therapy: Inhibitors of CiaH could potentially sensitize resistant S. pneumoniae to beta-lactam antibiotics, as CiaH mutations can confer increased resistance to these drugs .

  • Anti-virulence approach: Since the CiaH-CiaR system contributes to virulence , targeting it might reduce pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance.

  • Stress sensitization: Inhibiting CiaH might render S. pneumoniae more susceptible to host immune defenses by compromising its stress response capabilities .

  • Species-specific targeting: Differences in CiaH function between streptococcal species might allow for the development of species-specific inhibitors with reduced impact on beneficial microbiota.

Future research should focus on identifying small molecule inhibitors of CiaH and evaluating their efficacy in combination with existing antibiotics against resistant pneumococcal strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.