Recombinant Streptococcus pyogenes serotype M12 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

Lgt is indispensable for lipoprotein maturation, which impacts bacterial virulence, nutrient uptake, and stress resistance:

  • Lipoprotein Anchoring: Lgt catalyzes the first step in lipoprotein processing, enabling membrane attachment. In S. pyogenes, deletion of lgt disrupts surface lipoprotein expression, impairing interactions with host immune components like IgG3 .

  • Cation Acquisition: Studies in Streptococcus pneumoniae show that Δlgt mutants exhibit reduced zinc and manganese uptake, compromising oxidative stress resistance and growth in cation-depleted environments .

  • Carbon Source Utilization: In Streptococcus mutans, Lgt-deficient strains show impaired growth on melibiose, indicating its role in carbohydrate ABC transporter functionality .

Recombinant Production and Purification

Recombinant Lgt is produced via heterologous expression in E. coli, followed by affinity chromatography. Key parameters include:

ParameterDetails
Expression VectorpET-based system with optional tags (e.g., His-tag)
Yield~50 µg per batch (commercial sources)
Purity>90% (assessed via SDS-PAGE)
ApplicationsELISA, enzymatic assays, structural studies

The enzyme’s stability in glycerol-containing buffers allows long-term storage, making it suitable for high-throughput studies .

4.1. Vaccine Development

Lgt-processed lipoproteins are critical virulence factors in streptococci. Recombinant Lgt enables studies on lipoprotein-dependent immune evasion mechanisms. For example:

  • S. pyogenes lipoproteins bind human IgG3, modulating host immune responses .

  • Engineered glycoconjugate vaccines leveraging Lgt-modified proteins show promise in preclinical trials .

4.2. Pathogenesis Studies

Δlgt mutants of S. pyogenes exhibit:

  • Reduced survival in human blood and bronchoalveolar lavage fluid .

  • Attenuated virulence in murine models of pneumonia and sepsis .

4.3. Antibiotic Resistance

Lgt influences membrane integrity; its inhibition could sensitize streptococci to β-lactams and oxidative stress .

Therapeutic Potential

Targeting Lgt offers avenues for novel antimicrobial strategies:

  • Small-Molecule Inhibitors: Blocking diacylglyceryl transfer could disrupt lipoprotein-dependent nutrient uptake .

  • Vaccine Antigens: Recombinant Lgt-modified lipoproteins are being explored as vaccine candidates against streptococcal infections .

Key Research Challenges

  • Functional Redundancy: Some streptococci possess alternative pathways for lipoprotein processing, complicating therapeutic targeting .

  • Structural Flexibility: Lgt’s conformational changes during catalysis remain poorly characterized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
lgt; MGAS9429_Spy0476; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M12 (strain MGAS9429)
Target Names
lgt
Target Protein Sequence
MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDAIFDFILIAFPLAIVG ARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAYCYNKVLNPIHFLDIAA PSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEGSYRIPTFLYESLWNLLG FVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSLMFLGIRISQYVSALLIII GLIFVIKRRRQKGISYYQE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Streptococcus pyogenes?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in Streptococcus pyogenes that catalyzes the transfer of a diacylglyceryl moiety to prolipoproteins, which is essential for proper lipoprotein anchoring in the bacterial cell membrane . In S. pyogenes serotype M12 (strain MGAS9429), the lgt gene (locus name MGAS9429_Spy0476) encodes a full-length protein consisting of 259 amino acids with UniProt accession number Q1JMT5 . The enzyme belongs to the EC 2.4.99.- class and plays a fundamental role in the post-translational modification of bacterial lipoproteins, which are important for various cellular functions including nutrient acquisition, stress responses, and virulence .

How does lgt contribute to the pathogenicity of Streptococcus pyogenes?

Lgt contributes significantly to S. pyogenes pathogenicity through its role in lipoprotein processing and anchoring. Based on studies in related bacteria, functional lgt is critical for proper cellular localization of lipoproteins, many of which serve as virulence factors . When lgt is inactivated, as demonstrated in Listeria monocytogenes, there is impaired intracellular growth and increased release of lipoproteins into the culture supernatant, suggesting compromised bacterial fitness within host cells . In S. pyogenes specifically, lipoproteins (Lpps) are released into the growth medium within vesicle-like structures in minute amounts under normal conditions, but this release pattern may be altered when lgt functionality is compromised . Genomic studies indicate that S. pyogenes acquired numerous genes during its evolution into a human-specific pathogen, with many virulence factors potentially requiring proper lipoprotein processing by lgt for full functionality .

What are the optimal storage conditions for recombinant S. pyogenes lgt protein?

For optimal stability and activity maintenance of recombinant S. pyogenes serotype M12 Prolipoprotein diacylglyceryl transferase, the recommended storage conditions are as follows: The protein should be stored in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For short-term storage, working aliquots may be kept at 4°C for up to one week . For longer preservation, store at -20°C, and for extended storage periods, conserve at -20°C or -80°C . It is important to note that repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity . These storage recommendations are designed to maintain the structural integrity and enzymatic activity of the recombinant protein for experimental applications.

What is the relationship between lgt and lipoprotein release in vesicle-like structures?

The mechanism underlying this phenomenon likely involves the inability of prolipoproteins to undergo proper lipid modification in the absence of lgt, preventing their anchoring to the membrane. Comparative extracellular proteome analyses between wild-type strains and Δlgt mutants have provided systematic insights into this process, revealing distinct patterns of lipoprotein release . These findings have significant implications for understanding bacterial membrane dynamics, vesicle formation, and the potential impact on host-pathogen interactions, particularly considering that released lipoproteins may serve as potent immunomodulators during infection.

How does the function of lgt in S. pyogenes compare to its role in other Gram-positive bacteria?

In L. monocytogenes, inactivation of lgt impairs intracellular growth in different eukaryotic cell lines and leads to increased release of lipoproteins into the culture supernatant . Studies have identified 26 of 68 predicted lipoproteins specifically released into the extracellular proteome of L. monocytogenes Δlgt mutants . A notable difference between bacterial species concerns the relationship between lgt and Lsp (lipoprotein-specific signal peptidase II). Unlike in Escherichia coli (a Gram-negative bacterium), research has demonstrated that in Listeria, lipidation by lgt is not a prerequisite for activity of Lsp . This suggests potential differences in lipoprotein processing pathways between Gram-positive and Gram-negative bacteria.

In S. pyogenes specifically, the lgt-processed lipoproteins may have unique roles in host adaptation, considering that S. pyogenes is exclusively adapted to the human host . The evolutionary trajectory of S. pyogenes, including the acquisition of genes through lateral gene transfer events, may have shaped the specific repertoire of lipoproteins processed by lgt in this pathogen .

What experimental approaches can be used to verify predicted lipoproteins in S. pyogenes?

Experimental verification of predicted lipoproteins in S. pyogenes can be systematically accomplished through several complementary approaches, with lgt deletion serving as a powerful tool. The creation of Δlgt mutants provides an excellent strategy for lipoprotein verification, as demonstrated in studies with Listeria monocytogenes . In the absence of functional lgt, lipoproteins that would normally be anchored to the membrane are instead released into the culture supernatant, facilitating their identification .

A comprehensive verification protocol would include:

  • Comparative Extracellular Proteome Analysis: Comparing the extracellular proteomes of wild-type and Δlgt mutant strains using techniques such as 2D gel electrophoresis followed by mass spectrometry identification of differentially abundant proteins .

  • Bioinformatic Prediction and Validation: Utilizing algorithms to predict lipoproteins based on signal sequences and lipoboxes, followed by experimental validation of these predictions through the Δlgt approach .

  • Regulon-Specific Analysis: Creating double mutants (e.g., Δlgt Δprfa) to identify lipoproteins belonging to specific regulons, as demonstrated in the identification of PrfA-regulated lipoproteins in L. monocytogenes .

  • Pulse-Chase Experiments: Tracking the fate of newly synthesized lipoproteins in wild-type versus Δlgt strains to confirm altered processing and localization patterns.

This systematic approach has proven successful in identifying 26 of 68 predicted lipoproteins in L. monocytogenes and could be adapted for comprehensive verification of the S. pyogenes lipoprotein repertoire .

How can researchers characterize the interaction between S. pyogenes M12 proteins and human immunoglobulins?

Characterizing the interaction between S. pyogenes M12 proteins and human immunoglobulins requires a multifaceted approach combining protein biochemistry, immunological methods, and structural biology. Based on previous research with recombinant M12 protein from S. pyogenes CS24, the following methodological framework can be employed:

  • Enzyme-Linked Immunosorbent Assays (ELISA): Researchers have successfully used ELISA to demonstrate that purified, recombinant M12 protein binds selectively to human immunoglobulin G3 (IgG3) . This approach can determine binding specificity and relative affinity by testing various monoclonal human IgG3 myeloma proteins representing different Gm(allotypic) phenotypes .

  • Localization of Binding Domains: The binding site for IgG has been localized to an internal peptide encoded by a PvuII fragment of the gene emm12 . Similar fragment-based approaches can be used to map interaction domains in both the M12 protein and the corresponding regions in human immunoglobulins.

  • Allotypic Variation Analysis: Studies have shown selective binding patterns among different IgG3 allotypes. Of nine Caucasian IgG3 myeloma proteins tested, only two bound strongly to recombinant M12 protein, specifically those with allotypic phenotypes IgG3m(b+)(g-) and IgG3m(b-)(g+) . No binding was observed for seven IgG3 myeloma proteins of Oriental origin with various G3m phenotypes . This suggests that comprehensive analysis across diverse human populations is necessary for complete characterization.

  • Structural Studies: Advanced techniques such as X-ray crystallography or cryo-electron microscopy could provide atomic-level insights into the M12-IgG3 interaction interface, complementing the biochemical and immunological approaches.

These methodologies collectively enable detailed characterization of the molecular basis for the selective interaction between S. pyogenes M12 proteins and human immunoglobulins, with potential implications for understanding host-pathogen interactions and developing therapeutic strategies.

What techniques are most effective for studying lgt-dependent lipoprotein processing and localization?

The most effective techniques for studying lgt-dependent lipoprotein processing and localization in S. pyogenes combine genetic, biochemical, and imaging approaches to provide comprehensive insights. Based on successful methodologies employed in related studies, the following techniques are recommended:

  • Gene Deletion and Complementation: Creation of Δlgt mutants through splicing-by-overlapping-extension PCR followed by complementation studies to confirm phenotype specificity . This genetic approach provides the foundation for comparative analyses.

  • Subcellular Fractionation: Systematic separation of bacterial cell components (membrane, cytoplasm, cell wall, and extracellular fractions) followed by proteomic analysis to track lipoprotein distribution in wild-type versus Δlgt strains .

  • Metabolic Labeling: Incorporation of radiolabeled or chemically modified fatty acid precursors to track lipid modification of proteins, enabling direct assessment of lgt transferase activity in vivo.

  • Immunolocalization: Using antibodies against specific lipoproteins combined with immunofluorescence microscopy or immunogold electron microscopy to visualize their cellular localization with high resolution.

  • Vesicle Isolation and Characterization: Given that S. pyogenes releases lipoproteins within vesicle-like structures , techniques for vesicle isolation (ultracentrifugation, filtration, and density gradient separation) combined with proteomics and lipidomics provide insights into alternate lipoprotein trafficking pathways.

  • Mass Spectrometry: Advanced MS techniques to identify post-translational modifications, particularly lipid modifications, providing direct evidence of lgt activity on specific protein substrates.

This integrated approach enables comprehensive characterization of how lgt impacts lipoprotein processing, membrane anchoring, and potential release mechanisms in S. pyogenes, with implications for understanding bacterial physiology and pathogenesis.

How can researchers effectively design experiments to study the evolution of lgt in Streptococcus species?

Designing experiments to study the evolution of lgt in Streptococcus species requires an integrated approach combining comparative genomics, phylogenetics, and functional characterization. Based on evolutionary studies of S. pyogenes and related streptococci, the following experimental design strategies are recommended:

  • Phylogenomic Analysis: Construct comprehensive phylogenetic trees using genome-wide analyses of multiple Streptococcus species, as demonstrated in studies that established a clade containing S. equi, S. pyogenes, S. dysgalactiae, and S. canis . This provides the evolutionary framework for lgt comparative studies.

  • Comparative Sequence Analysis: Analyze lgt gene sequences across streptococcal species to identify conserved domains, variable regions, and potential signatures of selection. These analyses should include:

    • Calculation of Ka/Ks ratios to detect selective pressures

    • Identification of recombination events using methods such as RDP4

    • Determination of sequence conservation in catalytic domains versus regulatory regions

  • Reconciliation Analysis: Employ reconciliation analysis methodologies similar to those used to identify 113 genes gained on the lineage leading to S. pyogenes . This approach can reveal whether lgt has undergone duplication, loss, or horizontal transfer events during streptococcal evolution.

  • Functional Complementation: Test functional conservation by expressing lgt genes from different streptococcal species in an S. pyogenes Δlgt background, assessing the ability to restore wild-type phenotypes.

  • Substrate Specificity Evolution: Compare the repertoire of lipoproteins processed by lgt across different Streptococcus species, particularly focusing on species-specific virulence factors. This can be accomplished through comparative proteomics of wild-type and Δlgt mutants across species.

  • Host Adaptation Analysis: Since S. pyogenes is exclusively adapted to the human host , compare lgt activity and substrate profiles between strict human pathogens and host generalists within the pyogenic group to identify potential adaptations related to host specificity.

This multifaceted approach enables researchers to trace the evolutionary history of lgt in Streptococcus species and understand how changes in this enzyme may have contributed to the emergence of species-specific pathogenic traits, particularly the human host adaptation of S. pyogenes.

How can lgt-processed lipoproteins be exploited for vaccine development against S. pyogenes?

Lipoproteins processed by lgt represent promising candidates for S. pyogenes vaccine development due to their surface exposure, conservation across strains, and immunogenic properties. A strategic approach to exploiting these proteins for vaccine development would include:

  • Comprehensive Identification: Utilizing the Δlgt mutation approach to systematically identify all lipoproteins in S. pyogenes . This provides a complete repertoire of potential vaccine candidates that would normally be anchored to the bacterial surface through lgt-mediated lipid modification.

  • Conservation Analysis: Assessing the genetic conservation of identified lipoproteins across diverse S. pyogenes strains and serotypes. Highly conserved lipoproteins would offer broader protection against multiple strains, a critical consideration given the genetic diversity of S. pyogenes.

  • Immunogenicity Screening: Evaluating the ability of recombinant non-lipidated forms of these proteins to elicit protective immune responses in animal models. The selective binding observed between S. pyogenes M12 protein and specific human immunoglobulin phenotypes suggests the importance of considering human population diversity in vaccine design .

  • Epitope Mapping: Identifying specific epitopes within lgt-processed lipoproteins that elicit protective rather than non-protective or potentially harmful immune responses. This is particularly important given S. pyogenes' complex interactions with the human immune system.

  • Lipoprotein Cocktail Formulation: Developing multi-component vaccines containing several conserved lipoproteins to enhance efficacy and reduce the potential for vaccine escape through mutation of individual antigens.

This approach leverages the natural immunogenicity of bacterial surface lipoproteins while potentially avoiding the complications associated with lipid modifications, which might cause undesired inflammatory responses or cross-reactivity with host tissues.

What are the implications of lgt research for understanding bacterial evolution and host adaptation?

Research on lgt has significant implications for understanding bacterial evolution and host adaptation, particularly in the context of S. pyogenes' emergence as a strict human pathogen. The evolutionary significance of lgt can be analyzed across several dimensions:

  • Genomic Context and Evolutionary History: Comparative genomics studies have revealed that S. pyogenes gained 113 genes during its evolution, with almost half (46%) being phage-associated and 14 showing significant matches to experimentally verified bacterial virulence factors . The evolutionary history of lgt within this context provides insights into how core metabolic functions adapt during host specialization.

  • Lateral Gene Transfer Dynamics: Over half of the phage-associated genes in S. pyogenes were involved in 90 different lateral gene transfer (LGT) events, mostly between different S. pyogenes strains but also involving other species like the horse pathogen S. equi subsp. equi . Understanding whether lgt itself or its substrate lipoproteins have been subject to such transfers illuminates bacterial adaptation mechanisms.

  • Host-Specific Adaptation: As S. pyogenes is exclusively adapted to the human host, unlike many host generalists in the pyogenic group , lgt-processed lipoproteins may play crucial roles in this specialization. Comparative analysis of lgt substrates between S. pyogenes and closely related species like S. dysgalactiae (its likely sister species) could reveal host-specific adaptations .

  • Immune Evasion Strategies: The selective binding observed between S. pyogenes M12 protein and specific human immunoglobulin phenotypes suggests that lipoprotein-mediated interactions with the host immune system have evolved in ways that potentially benefit the pathogen. This represents a form of host adaptation at the molecular level.

  • Metabolic Adaptation: Beyond virulence, lgt-processed lipoproteins often function in nutrient acquisition and stress responses, which are critical for survival in the human host. Evolution of these functions likely contributed to S. pyogenes' adaptation to its human niche.

Understanding these evolutionary dimensions of lgt and its substrates provides valuable insights into the mechanisms underlying bacterial host adaptation and pathogen evolution, with potential implications for predicting the emergence of new pathogenic traits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.