Recombinant Streptococcus pyogenes serotype M2 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant PlsY

Recombinant PlsY is a 213-amino acid protein (UniProt ID: Q1JHA3) expressed in Escherichia coli with an N-terminal His tag for purification . It belongs to the acyltransferase family (EC 2.3.1.n3) and catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), initiating phosphatidic acid synthesis—a critical step in bacterial membrane phospholipid formation .

Enzymatic Activity and Inhibition

  • Catalytic role: Converts acyl-phosphate and G3P to lysophosphatidic acid, a precursor for membrane lipids .

  • Kinetic properties: Exhibits a low Michaelis constant (K<sub>m</sub>) for G3P, though exact values for the M2 serotype remain uncharacterized. Mutations in Motif 2 significantly reduce substrate binding efficiency .

  • Inhibition: Noncompetitively inhibited by palmitoyl-CoA, suggesting regulatory feedback mechanisms .

Production and Purification

Recombinant PlsY is produced under the following conditions:

ParameterSpecification
HostE. coli
TagN-terminal His tag
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol at -20°C or -80°C
StabilitySensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

The protein is commercially available for applications like ELISA and structural studies .

Genetic and Genomic Context

  • Gene locus: plsY (MGAS10270_Spy0768) is located on the chromosome of S. pyogenes M2 strain MGAS10270 .

  • Pathway association: Part of the phospholipid metabolism pathway, essential for bacterial membrane biogenesis .

Research Applications

  • Drug discovery: As a membrane-bound enzyme critical for bacterial survival, PlsY is a potential target for novel antibiotics. Inhibitors disrupting its active sites could impair bacterial viability .

  • Structural studies: Recombinant PlsY facilitates crystallography and mutagenesis experiments to explore mechanism-of-action details .

  • Immunoassays: Utilized in ELISA kits to generate antibodies for diagnostic or functional studies .

Future Directions

Further studies are needed to resolve the enzyme’s 3D structure and characterize its interaction with inhibitors. Additionally, comparative analyses across S. pyogenes serotypes could reveal serotype-specific functional variations.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice packaging is preferred, please inform us in advance, as additional charges may apply.
Notes
Avoid repeated freezing and thawing. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
plsY; MGAS10270_Spy0768; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M2 (strain MGAS10270)
Target Names
plsY
Target Protein Sequence
MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTTNTFRILGVKAGTATLAID MFKGTLSILLPIIFGMTSISSIAIGFFAVLGHTFPIFANFKGGKAVATSAGVLLGFAPLY LFFLASIFVLVLYLFSMISLASVVSAIVGVLSVLTFPAIHFLLPNYDYFLTFIVILLAFI IIIRHKDNISRIKHHTENLIPWGLNLSKQVPKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Notably, this enzyme utilizes acyl-phosphate as the fatty acyl donor, but does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of plsY and how does it relate to function?

Studies on Streptococcus pneumoniae PlsY have revealed a complex membrane topology consisting of five membrane-spanning segments. The protein's amino terminus and two short loops are located on the external face of the membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs essential for catalytic function . This structural arrangement positions the catalytic sites on the cytoplasmic side of the membrane, allowing interaction with cytosolic substrates while anchoring the enzyme within the lipid bilayer. Each of the three cytoplasmic domains contains distinct conserved motifs (designated as Motifs 1, 2, and 3) that contribute to different aspects of catalysis, including substrate binding and acyl transfer reactions. This membrane topology is critical for proper enzymatic function and represents an important structural feature for understanding plsY catalytic mechanism.

Why is Streptococcus pyogenes serotype M2 significant in plsY research?

Streptococcus pyogenes serotype M2 represents an important strain for studying virulence mechanisms in Group A Streptococcus (GAS). While specific research on plsY in serotype M2 is limited in the provided search results, this serotype has distinctive features that make it valuable for comprehensive GAS research. S. pyogenes serotype M2 carries a unique pilus type encoded in the FCT-6 genomic region that contributes to both host cell adhesion and immune evasion . Understanding how essential membrane proteins like plsY function in this serotype could provide insights into the relationship between membrane phospholipid composition and virulence structures such as pili. Additionally, as Group A Streptococcus is responsible for over 500,000 deaths annually worldwide, with emerging antimicrobial resistance, studying conserved enzymes like plsY in clinically relevant serotypes presents opportunities for developing novel therapeutic strategies .

What techniques are most effective for determining the membrane topology of plsY?

The substituted cysteine accessibility method (SCAM) has proven highly effective for determining the membrane topology of plsY, as demonstrated in studies with Streptococcus pneumoniae PlsY . This technique involves systematically replacing amino acids in the protein sequence with cysteines, then using membrane-impermeable sulfhydryl-reactive reagents to determine which cysteines are accessible from either side of the membrane. For recombinant expression of Streptococcus pyogenes plsY, researchers should consider:

  • Creating a cysteine-less version of plsY as a background for subsequent mutations

  • Introducing single cysteine substitutions at various positions throughout the protein

  • Expressing the protein in a suitable bacterial system (E. coli is commonly used)

  • Treating intact cells with membrane-impermeable sulfhydryl reagents

  • Lysing cells and treating with membrane-permeable reagents

  • Analyzing the labeling pattern to determine which portions are intracellular versus extracellular

This methodical approach would produce a comprehensive topology map identifying the membrane-spanning regions, cytoplasmic domains, and external loops of S. pyogenes serotype M2 plsY, which is critical for understanding structure-function relationships.

How can site-directed mutagenesis be optimized to study conserved motifs in plsY?

Site-directed mutagenesis represents a powerful approach for investigating the functional roles of conserved motifs in plsY. Based on research with S. pneumoniae PlsY, each of the three conserved motifs contains residues critical for catalysis that can be systematically analyzed . An optimized approach should include:

MotifKey ResiduesSuggested MutationsExpected Effect
Motif 1Serine, ArginineS→A, R→K, R→ADisruption of catalytic function
Motif 2Conserved GlycinesG→A (each position)Altered glycerol-3-phosphate binding
Motif 3Histidine, Asparagine, GlutamateH→A, N→A, E→A, E→DChanges in activity and structural integrity

When analyzing mutants, researchers should employ multiple complementary approaches:

  • Express and purify recombinant proteins with individual mutations

  • Conduct in vitro enzymatic assays measuring the conversion of acylphosphate and glycerol-3-phosphate to the acylated product

  • Determine kinetic parameters (Km, Vmax) for each mutant

  • Perform thermal stability assays to distinguish between catalytic defects and structural instability

  • Create corresponding mutations in vivo and assess their impact on bacterial growth and membrane composition

This comprehensive mutational analysis would provide detailed insights into the catalytic mechanism of S. pyogenes plsY and identify residues essential for enzymatic function.

What are the optimal conditions for measuring plsY enzymatic activity in vitro?

Based on studies with related acyltransferases, optimal conditions for measuring Streptococcus pyogenes serotype M2 plsY enzymatic activity should be carefully established. A robust enzymatic assay would include:

  • Buffer composition: Typically 50-100 mM Tris-HCl or HEPES buffer (pH 7.4-7.8)

  • Salt concentration: 100-150 mM NaCl to maintain ionic strength

  • Divalent cations: 5-10 mM MgCl₂ (which often enhances acyltransferase activity)

  • Substrate concentrations:

    • Acylphosphate: 10-100 μM (likely limiting substrate)

    • Glycerol-3-phosphate: 0.1-1 mM

  • Detergent: 0.01-0.05% non-ionic detergent (e.g., Triton X-100) to maintain enzyme solubility

  • Temperature: 30-37°C (physiological temperature for S. pyogenes)

  • Reaction time: Initial velocity measurements (1-5 minutes)

Activity can be measured by:

  • Monitoring the disappearance of acylphosphate

  • Quantifying the formation of acylated glycerol-3-phosphate

  • Using radiolabeled substrates for enhanced sensitivity

  • Coupling the reaction to detectable secondary reactions

Given that PlsY is noncompetitively inhibited by palmitoyl-CoA , researchers should avoid contamination with CoA derivatives when preparing assay components. Control experiments should include heat-inactivated enzyme and reactions without glycerol-3-phosphate to account for non-specific hydrolysis of acylphosphate.

How do mutations in plsY affect bacterial membrane composition and virulence in Streptococcus pyogenes?

While specific studies on S. pyogenes plsY mutations are not detailed in the search results, research on related bacterial membrane proteins suggests significant effects on both membrane composition and virulence. The essential role of plsY in phospholipid biosynthesis means that mutations would likely result in:

  • Altered phospholipid composition affecting membrane fluidity and permeability

  • Changes in membrane protein integration and function

  • Modified surface properties affecting host cell interactions

  • Potential impacts on pilus assembly and function

In S. pyogenes serotype M2, the FCT-6 pilus plays a critical role in host cell adhesion and immune evasion, with the backbone pilin binding to host factors including fibronectin and fibrinogen . Disruption of membrane phospholipid composition through plsY mutations could potentially affect the anchoring and assembly of these pilus structures. This connection between membrane physiology and virulence structures represents an important avenue for future research, particularly exploring whether:

  • Subtle mutations in plsY that alter (rather than abolish) enzyme activity result in changes to membrane phospholipid composition

  • These changes affect the expression or assembly of virulence factors like the FCT-6 pilus

  • Such modifications alter immune evasion properties, including delayed blood clotting and increased intracellular survival in macrophages observed with intact FCT-6 pili

Research in this area would benefit from combining genetic approaches with lipidomic analysis and virulence assays in appropriate model systems.

What is the relationship between plsY activity and bacterial survival under different physiological stresses?

The essential role of plsY in membrane phospholipid biosynthesis suggests its activity would significantly impact bacterial survival under various physiological stresses. Advanced research should investigate how S. pyogenes modulates plsY activity when facing:

  • Temperature stress: Changes in environmental temperature require membrane fluidity adjustments, potentially through altered acyl chain composition

  • Osmotic stress: Hyperosmotic conditions may necessitate changes in membrane phospholipid composition

  • pH fluctuations: Acidic environments encountered during host colonization may require membrane adaptations

  • Immune system encounters: Contact with host immune factors may trigger membrane remodeling

  • Antibiotic exposure: Sub-lethal antibiotic concentrations may induce compensatory changes in membrane composition

Research approaches should include:

  • Exposing S. pyogenes to controlled stress conditions and measuring plsY expression and activity

  • Creating conditional plsY mutants with varied expression levels to determine threshold requirements under stress

  • Analyzing membrane phospholipid profiles under different stress conditions using lipidomics

  • Correlating changes in plsY activity with stress survival and virulence expression

Such studies would provide insights into how this essential enzyme contributes to S. pyogenes adaptability and pathogenesis across diverse host environments.

How might recombinant production of plsY be optimized for structural studies?

Optimizing recombinant production of Streptococcus pyogenes serotype M2 plsY for structural studies presents significant challenges due to its integral membrane nature. An effective strategy would incorporate lessons from successful membrane protein structural studies:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Cell-free translation systems for difficult-to-express proteins

    • Alternative hosts like Lactococcus lactis for streptococcal proteins

  • Construct optimization:

    • Addition of solubility-enhancing fusion partners (MBP, SUMO)

    • Inclusion of purification tags positioned to avoid interference with folding

    • Creating truncated constructs of individual domains for complementary studies

  • Expression conditions:

    • Lower induction temperatures (16-20°C)

    • Reduced inducer concentrations

    • Extended expression periods (24-48 hours)

  • Solubilization and purification:

    • Screening multiple detergents (DDM, LDAO, etc.)

    • Utilizing lipid nanodiscs or amphipols for maintaining native-like environment

    • Implementing size-exclusion chromatography as a final purification step

  • Stability assessment:

    • Thermal shift assays to identify stabilizing conditions

    • Limited proteolysis to identify stable domains

    • Activity assays to confirm functional protein

For structural determination:

  • X-ray crystallography would require highly pure, homogeneous, and stable protein in suitable detergents

  • Cryo-electron microscopy might be more forgiving of heterogeneity

  • NMR studies could focus on specific domains or require isotopic labeling

The successful engineering of the Group A Carbohydrate biosynthesis pathway for recombinant production provides a valuable precedent for complex streptococcal systems, suggesting similar bioengineering approaches might be applicable to plsY expression.

How does plsY from Streptococcus pyogenes compare to other bacterial acyltransferases?

Comparative analysis of plsY across bacterial species reveals important evolutionary relationships and functional conservation. While specific comparisons for S. pyogenes serotype M2 plsY are not detailed in the search results, research on S. pneumoniae plsY provides valuable insights . Key comparative aspects include:

  • Conservation of membrane topology:

    • The five membrane-spanning segments with three cytoplasmic domains containing conserved motifs appear to be a defining feature of the PlsY family

    • This topological arrangement likely represents an evolutionarily conserved solution for performing acyl transfer at the membrane interface

  • Preservation of critical motifs:

    • Motif 1 with essential serine and arginine residues

    • Motif 2 resembling a phosphate-binding loop involved in glycerol-3-phosphate binding

    • Motif 3 containing conserved histidine, asparagine, and glutamate residues important for activity and structural integrity

  • Substrate specificity differences:

    • Variations in acyl chain length preferences between species

    • Different sensitivities to inhibition by palmitoyl-CoA and related compounds

A rigorous comparative analysis would involve:

  • Multiple sequence alignment of plsY proteins from diverse bacterial species

  • Structural modeling based on any available crystal structures

  • Biochemical characterization of enzyme kinetics across species

  • Heterologous expression studies to test functional complementation

Such comparative studies would highlight unique features of S. pyogenes plsY that might be exploited for species-specific inhibitor development, while also revealing fundamental aspects of acyltransferase evolution.

What insights can be gained from studying plsY in the context of streptococcal pathogenesis?

Studying plsY within the broader context of streptococcal pathogenesis offers significant insights into the connections between basic bacterial physiology and virulence. Group A Streptococcus (GAS) is responsible for over 500 million cases of pharyngitis annually and more than 500,000 deaths globally from severe infections . Understanding how fundamental processes like membrane phospholipid biosynthesis interact with virulence mechanisms would provide valuable perspectives.

Key research questions in this context include:

  • Does membrane phospholipid composition affect the expression or function of virulence factors?

    • The serotype M2 FCT-6 pilus contributes to both adhesion and immune evasion

    • Proper membrane anchoring of these structures may depend on specific lipid environments

  • Are there membrane composition changes during different infection stages?

    • Transition from colonization to invasion may involve membrane remodeling

    • Adaptation to different host tissues might require phospholipid composition adjustments

  • How does plsY activity respond to host defense mechanisms?

    • Antimicrobial peptides target bacterial membranes

    • Potential compensatory changes in phospholipid synthesis

  • Could plsY inhibition sensitize S. pyogenes to host defenses or antibiotics?

    • Synergistic effects between membrane disruption and other antimicrobial mechanisms

    • Potential for combination therapeutic approaches

Integrating knowledge about basic membrane physiology with virulence mechanisms could reveal new therapeutic targets or strategies for controlling GAS infections, particularly as antimicrobial resistance emerges globally .

How might inhibitors of plsY be developed as potential antimicrobial agents?

The essential role of plsY in bacterial membrane phospholipid biosynthesis makes it an attractive target for antimicrobial development. Several approaches for developing plsY inhibitors could be pursued:

  • Structure-based drug design:

    • Using the known topology and conserved motifs of plsY

    • Targeting the glycerol-3-phosphate binding site in Motif 2

    • Focusing on the essential catalytic residues in Motif 1 (serine and arginine)

  • High-throughput screening approaches:

    • Developing assays to measure plsY activity in a high-throughput format

    • Screening chemical libraries for compounds that inhibit enzyme function

    • Focusing on compounds that demonstrate selectivity for bacterial over mammalian acyltransferases

  • Exploiting natural inhibition mechanisms:

    • The noncompetitive inhibition by palmitoyl-CoA suggests potential for developing mimetics

    • Exploring structural analogs with improved potency and pharmacokinetic properties

  • Computational approaches:

    • Molecular docking studies to identify potential binding pockets

    • Virtual screening of compound libraries

    • Machine learning to predict inhibitory potential based on known structure-activity relationships

The ideal plsY inhibitor would demonstrate:

  • Potent inhibition of bacterial enzyme activity

  • Limited activity against mammalian acyltransferases

  • Ability to penetrate bacterial membranes

  • Stability in physiological conditions

  • Limited potential for resistance development

Development of such inhibitors could provide valuable new therapeutic options against Group A Streptococcus, which remains a significant global health burden with over 500,000 deaths annually .

What role might plsY research play in vaccine development against Streptococcus pyogenes?

While plsY itself may not be an ideal vaccine antigen due to its membrane-embedded nature, research on this enzyme contributes valuable knowledge to vaccine development efforts. Current approaches to Streptococcus pyogenes vaccine development include:

  • Glycoconjugate vaccines:

    • The Group A Carbohydrate containing a rhamnose polysaccharide (RhaPS) backbone represents a universal vaccine candidate

    • Recombinant production platforms have been developed to couple RhaPS to carrier proteins within E. coli cells

    • Understanding membrane biosynthesis pathways involving plsY could inform optimization of such recombinant systems

  • Protein-based vaccines:

    • Surface proteins like the serotype M2 pilus components are potential vaccine antigens

    • Knowledge of membrane physiology and protein anchoring mechanisms involving phospholipids produced via plsY activity could improve antigen selection and production

  • Combination approaches:

    • Targeting both carbohydrate and protein antigens may provide more comprehensive protection

    • Understanding the interplay between membrane composition and surface structure presentation

Research data indicates that purified RhaPS glycoconjugates elicit carbohydrate-specific antibodies in mice and rabbits and bind to the surface of multiple Strep A strains of diverse M-types . Similar rigorous validation would be needed for any vaccine approach informed by plsY research.

The global imperative for a Strep A vaccine, highlighted by WHO prioritization , underscores the importance of fundamental research into all aspects of S. pyogenes biology, including membrane phospholipid biosynthesis through enzymes like plsY.

What emerging technologies could advance our understanding of plsY function in bacterial membranes?

Several cutting-edge technologies hold promise for deepening our understanding of plsY function in Streptococcus pyogenes membranes:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize plsY localization within bacterial membranes

    • Single-molecule tracking to observe dynamics and interactions with other proteins

    • Cryo-electron tomography to visualize membrane architecture in native state

  • Genetic engineering approaches:

    • CRISPR-Cas9 genome editing for precise modification of plsY in S. pyogenes

    • Inducible expression systems to control plsY levels in real-time

    • Fluorescent protein fusions compatible with streptococcal expression

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics

    • Network analysis of phospholipid metabolism and virulence factor expression

    • Machine learning to identify non-obvious relationships between membrane composition and bacterial phenotypes

  • Structural biology advances:

    • AlphaFold and other AI-based structure prediction tools

    • Nanodiscs and other membrane mimetics for maintaining native environments

    • Time-resolved structural studies to capture enzymatic intermediates

  • Synthetic biology applications:

    • Minimal synthetic membrane systems incorporating purified plsY

    • Cell-free expression systems for difficult-to-express membrane proteins

    • Engineered biosynthetic pathways similar to those developed for Group A Carbohydrate production

These technologies could address key questions about spatial organization of membrane biosynthesis, temporal regulation of plsY activity, and integration of membrane physiology with virulence mechanisms in Group A Streptococcus.

How might plsY research contribute to addressing global antimicrobial resistance challenges?

Research on plsY and bacterial membrane biosynthesis has significant potential to address the growing global challenge of antimicrobial resistance:

  • Novel target development:

    • Membrane biosynthesis enzymes like plsY represent underexploited antimicrobial targets

    • Targeting essential cellular processes may have higher barriers to resistance development

    • Structure-based drug design informed by detailed plsY characterization could yield new antimicrobial classes

  • Combination therapy approaches:

    • Understanding how membrane composition affects antibiotic penetration

    • Potential for synergistic effects between plsY inhibitors and existing antibiotics

    • Sensitization of resistant bacteria through membrane perturbations

  • Pathogen-specific targeting:

    • Identifying unique features of S. pyogenes plsY compared to commensal bacteria

    • Developing narrow-spectrum agents that preserve beneficial microbiota

    • Reducing selection pressure on the broader microbial community

  • Alternative therapeutic strategies:

    • Attenuating virulence rather than killing bacteria outright

    • Membrane modifications that enhance host immune recognition

    • Vaccine approaches targeting conserved surface structures depending on membrane anchoring

With Group A Streptococcus responsible for over 500,000 deaths annually and antimicrobial resistance emerging globally , fundamental research on membrane biosynthesis enzymes like plsY aligns with the WHO's prioritization of new approaches to combat this pathogen . Such research contributes to the broader scientific effort to address antimicrobial resistance through diverse, innovative strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.