Recombinant Streptococcus pyogenes serotype M3 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SPs1230; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M3 (strain SSI-1)
Target Names
plsY
Target Protein Sequence
MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTTNTFRILGVKAGTATLAID MFKGTLSILLPIIFGMTSISSIAIGFFAVLGHTFPIFANFKGGKAVATSAGVLLGFAPLY LFFLASIFVLVLYLFSMISLASVVSAIVGVLSVLTFPAIHFLLPNYDYFLTFIVILLAFI IIIRHKDNISRIKHHTENLIPWGLNLSKQVPKK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: sps:SPs1230

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Streptococcus pyogenes?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first step in phospholipid biosynthesis in Streptococcus pyogenes, transferring an acyl group from acyl-acyl carrier protein (acyl-ACP) to glycerol-3-phosphate to form lysophosphatidic acid. This reaction is essential for bacterial membrane formation and integrity. In serotype M3 strains, which are associated with unusually severe infections and higher mortality rates compared to other GAS strains, membrane composition can affect virulence factor expression and host-pathogen interactions . The enzyme is part of the bacterial phospholipid biosynthetic pathway that differs from the mammalian pathway, making it a potential target for antimicrobial development.

How does serotype M3 Streptococcus pyogenes differ from other serotypes?

Serotype M3 strains of Streptococcus pyogenes are associated with unusually severe infections and a high mortality rate. Genome sequencing of strain MGAS315 (a representative M3 strain) revealed that phage-like elements account for the majority of variation in gene content relative to other sequenced strains. Contemporary M3 isolates express a unique combination of virulence factors including the SpeA3 variant of streptococcal pyrogenic exotoxin A (which is approximately 50% more mitogenic than earlier variants), as well as SpeK, streptococcal superantigen (SSA), and phospholipase A2 (Sla) . This combination of phage-encoded virulence factors likely contributes to the enhanced pathogenicity observed in these strains. The membrane composition, which is directly influenced by plsY activity, may affect the expression and functionality of these virulence factors.

What expression systems are recommended for recombinant production of S. pyogenes plsY?

For recombinant production of S. pyogenes plsY, E. coli-based expression systems are most commonly recommended due to their high yield and ease of genetic manipulation. Based on protocols developed for other streptococcal proteins, the pCold-I vector system has proven effective for expression of challenging bacterial proteins . This system includes features like an N-terminal His6-tag for purification and cold-shock expression to improve protein folding. For membrane-associated proteins like plsY:

  • Consider using E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression

  • Optimize expression conditions using reduced temperature (16-20°C)

  • Include appropriate detergents during purification (e.g., n-dodecyl-β-D-maltoside) to maintain protein stability

  • Incorporate TEV protease cleavage sites rather than trypsin sites if structural studies are planned, as this allows better control over the final protein product

What purification strategies work best for maintaining enzymatic activity of recombinant plsY?

Purification of recombinant plsY from S. pyogenes requires careful consideration of its membrane-associated nature. A multi-step purification strategy typically yields the best results:

  • Affinity chromatography: Utilize the His6-tag with Ni-NTA resin in the presence of mild detergents

  • Size exclusion chromatography: Separate oligomeric states and remove aggregates

  • Buffer optimization: Include glycerol (10-20%) and reducing agents to maintain stability

Purification StepBuffer CompositionCritical ParametersExpected Yield
Cell lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitorsComplete lysis without overheatingN/A
Ni-NTA affinity50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.1% n-dodecyl-β-D-maltoside, 20-250 mM imidazole gradientSlow flow rate (0.5 mL/min), thorough washing10-15 mg/L culture
Tag cleavageSame as above with 1:50 TEV protease, overnight at 4°CComplete cleavage verification by SDS-PAGE>90% cleavage
Size exclusion25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 0.05% n-dodecyl-β-D-maltosideLoad concentrated sample (<2 mL)5-8 mg/L culture

Enzymatic activity should be verified after each purification step, with enzyme assays performed under conditions that mimic physiological parameters of S. pyogenes .

How can enzymatic activity of plsY be reliably measured in vitro?

Reliable measurement of plsY enzymatic activity requires consideration of both substrate specificity and assay conditions:

  • Coupled enzyme assay method:

    • Monitor the release of free CoA using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB)

    • Reaction mixture: 100 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 50 μM glycerol-3-phosphate, 50 μM acyl-ACP, purified plsY enzyme

    • Read absorbance at 412 nm in kinetic mode

  • Radiometric assay method:

    • Use ¹⁴C-labeled glycerol-3-phosphate or ³H-labeled acyl-ACP

    • Extract lipid products using chloroform/methanol mixture

    • Analyze by thin-layer chromatography and quantify by scintillation counting

  • HPLC-based method:

    • Detect formation of lysophosphatidic acid using reverse-phase HPLC

    • Sample preparation includes lipid extraction and derivatization steps

When evaluating enzyme kinetics, it's important to determine temperature and pH optima specifically for the serotype M3 variant, as these can differ from other strains. Initial velocity measurements across substrate concentration ranges from 5-100 μM are recommended for accurate Km and Vmax determination .

What are the challenges in crystallizing recombinant plsY for structural studies?

Crystallizing membrane-associated enzymes like plsY presents several challenges:

  • Protein stability issues:

    • Membrane proteins often require specific detergents to maintain stability

    • Detergent micelles can interfere with crystal packing

  • Conformational heterogeneity:

    • plsY may exist in multiple conformational states, complicating crystallization

    • Consider using substrate analogs or inhibitors to lock the enzyme in a specific conformation

  • Crystal screening approaches:

    • Initial screening should include membrane protein-specific screens

    • Lipidic cubic phase (LCP) crystallization may be more successful than vapor diffusion methods

Studies on other streptococcal enzymes have revealed unusual structural features that may affect crystallization. For example, GapN from S. pyogenes was found to contain an unusual cis-peptide near the catalytic site . Similar structural peculiarities might exist in plsY, requiring extensive screening conditions.

Crystallization ApproachAdvantagesChallengesSuccess Rate in Similar Proteins
Vapor diffusionSimple setup, widely usedLower success with membrane proteins<10%
Lipidic cubic phaseMimics membrane environmentComplex setup, requires specialized equipment20-30%
Bicelle methodIntermediate complexitySensitive to temperature15-20%
In meso crystallizationGood for highly hydrophobic proteinsRequires specific lipids20-25%

How does the structure-function relationship of plsY contribute to bacterial membrane composition in S. pyogenes serotype M3?

The structure-function relationship of plsY directly influences the phospholipid composition of S. pyogenes membranes, which in turn affects various aspects of bacterial physiology:

  • Substrate specificity and membrane fatty acid profile:

    • plsY shows preference for specific acyl-ACP chain lengths, influencing membrane fluidity

    • Serotype M3 strains may have evolved plsY variants with altered substrate preferences to optimize membrane properties for virulence

  • Regulatory mechanisms:

    • Feedback inhibition by end products may regulate membrane composition in response to environmental conditions

    • Post-translational modifications could modulate enzyme activity during different growth phases

  • Impact on virulence:

    • Membrane composition affects insertion and function of virulence factors

    • Altered phospholipid profiles can influence resistance to host antimicrobial peptides

    • Membrane characteristics may influence phage integration, which is a major contributor to M3 strain virulence

Research approaches should combine structural biology techniques with lipidomic analysis to correlate enzyme function with membrane composition and virulence factor expression. Comparative studies with plsY from different serotypes could highlight serotype-specific adaptations that contribute to the enhanced virulence of M3 strains.

How can site-directed mutagenesis of plsY inform drug design strategies against S. pyogenes?

Site-directed mutagenesis of plsY can provide critical insights for antimicrobial drug design through:

  • Identification of catalytic residues:

    • Alanine scanning mutagenesis of conserved residues to identify those essential for activity

    • Mutations at binding sites for both glycerol-3-phosphate and acyl-ACP can reveal distinct pockets for inhibitor design

  • Species-specific targeting:

    • Compare sequences and structures with human glycerol-3-phosphate acyltransferases

    • Identify unique features in S. pyogenes plsY that could be exploited for selective inhibition

  • Resistance mechanism prediction:

    • Introduce mutations mimicking potential resistance mechanisms

    • Evaluate their impact on enzyme function and inhibitor binding

A methodical approach would involve:

  • Creating a library of single and double mutants targeting predicted active site residues

  • Assessing enzyme kinetics for each mutant (Km, Vmax, substrate preference)

  • Performing molecular dynamics simulations to understand conformational changes

  • Crystallizing successful mutants to confirm structural hypotheses

This approach mirrors successful strategies used with other streptococcal enzymes, such as the identification of GapN as an essential enzyme and potential antimicrobial target in S. pyogenes . Like GapN, plsY may contain unique structural features that can be exploited for selective inhibition.

What is the impact of mobile genetic elements on plsY expression and function in hypervirulent M3 strains?

The relationship between mobile genetic elements and plsY in hypervirulent M3 strains involves complex interactions that may influence pathogenicity:

  • Regulatory effects:

    • Phage-encoded transcription factors may modulate plsY expression

    • Integration sites of mobile elements could disrupt or enhance native regulatory mechanisms

  • Co-evolution with virulence factors:

    • Phage-encoded factors like SpeA, SpeK, and Sla found in M3 strains may require specific membrane properties for optimal function

    • plsY activity may be fine-tuned to support these specialized virulence requirements

  • Horizontal gene transfer considerations:

    • While core metabolic genes like plsY are typically chromosomally encoded, regulatory elements affecting their expression can be transferred horizontally

    • Comparative genomic analysis across clinical isolates can reveal patterns of co-selection

Research approaches should include:

  • Transcriptomic analysis comparing plsY expression in isogenic strains with and without specific phage elements

  • Reporter gene assays to identify trans-acting factors affecting plsY expression

  • Lipidomic analysis to correlate membrane composition with virulence factor expression

The genome of serotype M3 strain MGAS315 revealed that phage-like elements account for the majority of variation in gene content relative to other sequenced strains, and these elements encode several virulence factors that contribute to the high virulence phenotype . Understanding how these mobile genetic elements affect fundamental processes like membrane biosynthesis could provide new insights into bacterial pathogenesis.

How can protein aggregation issues be addressed when working with recombinant plsY?

Protein aggregation is a common challenge when working with membrane-associated enzymes like plsY. Several strategies can help mitigate this issue:

  • Expression optimization:

    • Reduce expression temperature to 16-20°C to slow protein synthesis

    • Use strains engineered for membrane protein expression (C41/C43)

    • Consider codon optimization for rare codons in E. coli

  • Buffer and additive screening:

    • Test multiple detergents at concentrations above their critical micelle concentration

    • Include stabilizing additives like glycerol (10-20%), specific lipids, or mild reducing agents

    • Optimize ionic strength and pH based on theoretical isoelectric point

  • Fusion partner strategies:

    • N-terminal fusion partners like MBP (maltose-binding protein) can enhance solubility

    • Include TEV protease sites for removal rather than trypsin, which may cause degradation of partially unfolded regions

DetergentCMC (mM)Recommended Working ConcentrationAdvantages
n-Dodecyl-β-D-maltoside0.170.2-0.5%Gentle, maintains activity
Digitonin0.50.5-1.0%Good for oligomeric complexes
CHAPS8-100.5-1.0%Less denaturing, easily dialyzable
LMNG0.010.01-0.05%Stable micelles, low background

If aggregation persists despite these measures, consider nanodiscs or amphipols as alternative membrane mimetics for stabilizing the protein in a native-like environment.

What strategies can resolve substrate specificity conflicts in heterologous expression systems?

When expressing S. pyogenes plsY in heterologous systems, substrate specificity conflicts may arise due to differences in available acyl-ACPs and other metabolic factors:

  • Co-expression approaches:

    • Co-express S. pyogenes acyl-ACP synthetase and ACP with plsY

    • Create a synthetic operon containing all necessary components

  • Substrate supplementation:

    • Add purified S. pyogenes ACP to reaction mixtures

    • Use chemically synthesized acyl-ACP analogs with defined chain lengths

  • Chimeric enzyme design:

    • Create chimeric constructs with E. coli binding domains but S. pyogenes catalytic domains

    • Engineer substrate binding sites for compatibility with available substrates

A comprehensive approach involves characterizing the acyl-chain preferences of S. pyogenes plsY using a panel of defined substrates, then designing an expression system that provides the optimal substrate profile. This methodology parallels approaches used for other streptococcal enzymes where substrate availability in heterologous systems has been a limiting factor .

How might plsY contribute to metabolic adaptation during S. pyogenes infection progression?

The role of plsY in metabolic adaptation during infection involves dynamic responses to changing host environments:

  • Nutrient availability fluctuations:

    • As S. pyogenes transitions from colonization to invasion, available carbon sources change

    • plsY activity may be regulated to optimize membrane composition under nutrient limitation

    • Adaptation to low-phosphate environments may involve altered phospholipid metabolism

  • Host defense evasion:

    • Membrane composition affects susceptibility to host antimicrobial peptides

    • plsY-mediated alterations in phospholipid composition may contribute to innate immunity evasion

    • Changes in membrane properties can affect surface protein presentation and recognition by host immune components

  • Biofilm formation dynamics:

    • Phospholipid composition influences cell-cell interactions and adhesion properties

    • plsY activity modulation may facilitate transitions between planktonic and biofilm states

    • Serotype M3 strains with unique virulence profiles may exhibit distinct biofilm characteristics requiring specific membrane properties

Research approaches should include in vivo transcriptomics to track plsY expression during different infection stages, isotope labeling to monitor phospholipid turnover rates, and infection models that allow sampling across multiple tissue environments.

What role might plsY play in antimicrobial resistance development in S. pyogenes?

The relationship between plsY and antimicrobial resistance in S. pyogenes encompasses several potential mechanisms:

  • Membrane permeability modulation:

    • Altered phospholipid composition can reduce uptake of hydrophilic antibiotics

    • Changes in membrane fluidity affect penetration of hydrophobic compounds

    • Charged phospholipid distribution influences interaction with cationic antimicrobials

  • Stress response coordination:

    • Membrane remodeling is a key component of bacterial stress responses

    • plsY regulation may be integrated with systems that detect and respond to antibiotic stress

    • Coordinate regulation with efflux pump expression could enhance resistance

  • Interaction with macrolide resistance mechanisms:

    • Serotype M3 strains are often associated with macrolide resistance

    • Membrane composition may affect the efficiency of ribosomal protection mechanisms

    • Phospholipid environment could influence target site accessibility

Experimental approaches should include lipidomic analysis of resistant versus susceptible strains, evaluation of membrane fluidity changes in response to antibiotic exposure, and combinatorial studies testing plsY inhibitors with existing antibiotics to identify synergistic interactions.

How can systems biology approaches integrate plsY function with broader metabolic networks in S. pyogenes?

Systems biology approaches provide powerful frameworks for understanding plsY in the context of S. pyogenes metabolism:

  • Metabolic flux analysis:

    • Use ¹³C-labeled precursors to trace carbon flow through phospholipid synthesis pathways

    • Identify metabolic bottlenecks and regulatory nodes affecting membrane composition

    • Compare flux distributions between different serotypes, particularly M3 versus less virulent strains

  • Multi-omics integration:

    • Correlate transcriptomic, proteomic, and lipidomic data to build comprehensive models

    • Identify conditional dependencies between plsY expression and virulence factor production

    • Map relationships between central carbon metabolism and membrane biosynthesis

  • Network modeling approaches:

    • Construct genome-scale metabolic models incorporating membrane biogenesis

    • Perform in silico gene deletion studies to predict synthetic lethal interactions

    • Model metabolic adaptations in different host environments

This systems-level understanding could reveal unexpected connections between phospholipid metabolism and virulence, similar to discoveries about GapN's essential role in NADPH generation due to S. pyogenes lacking the oxidative pentose phosphate pathway . Such metabolic peculiarities often create vulnerabilities that can be exploited for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.