Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yidC2; SPs1603; Membrane protein insertase YidC 2; Foldase YidC 2; Membrane integrase YidC 2; Membrane protein YidC 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-307
Protein Length
Full Length of Mature Protein
Species
Streptococcus pyogenes serotype M3 (strain SSI-1)
Target Names
yidC2
Target Protein Sequence
CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Database Links

KEGG: sps:SPs1603

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of YidC2 in Streptococcus pyogenes?

YidC2 belongs to the YidC/Oxa1/Alb3 family of membrane protein insertases and chaperones. In streptococcal species, YidC2 plays crucial roles in membrane protein insertion, cell surface biogenesis, and protein secretion. Research has demonstrated that YidC2 contributes significantly to stress tolerance (including acid, osmotic, and oxidative stress), membrane-associated ATPase activity, and genetic competence . Unlike its paralog YidC1, which has less severe effects when disrupted, YidC2 is essential for maintaining cellular homeostasis under stressful conditions .

How does the function of YidC2 differ from YidC1 in streptococcal species?

Although YidC1 and YidC2 are paralogs belonging to the same protein family, they have distinct functional roles:

  • YidC2 disruption results in more severe phenotypes, including loss of genetic competence, decreased membrane-associated ATPase activity, and heightened sensitivity to various stresses (acid, osmotic, and oxidative)

  • YidC1 elimination has less pronounced effects on growth and stress sensitivity

  • The functional differences between these proteins are largely attributed to their C-terminal domains, as demonstrated by complementation studies using chimeric proteins

  • While both proteins contribute to cell surface biogenesis and protein secretion, they appear to affect extracellular protein profiles differently - elimination of YidC2 decreases levels of certain extracellular proteins (GtfB, GtfC, and adhesin P1), while elimination of YidC1 increases these same proteins

What experimental approaches are used to study YidC2 function?

Researchers typically employ several methodologies to investigate YidC2 function:

  • Gene knockout studies: Creating deletion mutants (ΔyidC2) to observe phenotypic changes

  • Conditional expression systems: Developing strains where YidC2 expression can be controlled by specific promoters (e.g., the carbon-catabolite-repressible celB promoter)

  • Chimeric protein construction: Creating fusion proteins with swapped domains to identify functionally important regions

  • Stress tolerance assays: Growing strains under various stressful conditions (acid, osmotic, oxidative) to assess functional impairment

  • Enzyme activity assays: Measuring membrane-associated ATPase activity and extracellular enzymatic functions

  • Protein secretion analysis: Examining alterations in the extracellular protein profile

  • In vivo pathogenicity models: Using animal models (e.g., rat caries model) to assess virulence contributions

How can a conditional expression system be established to study essential membrane proteins like YidC2?

Establishing a conditional expression system for essential membrane proteins requires careful genetic manipulation:

  • Select an appropriate inducible/repressible promoter: For studying YidC2, the carbon-catabolite-repressible celB promoter has proven effective. This promoter is induced by cellobiose but repressed by mannose .

  • Construction strategy:

    • Amplify the target promoter (PcelB) using PCR with specific primers (e.g., SP13F and SP13R as used in previous studies)

    • Amplify the yidC2 gene using appropriate primers (e.g., SP14F and SP05R)

    • Ligate both PCR products into a suitable cloning vector (e.g., pCR2.1)

    • Create the promoter fusion (PcelB-yidC2) and transfer to an integration vector (e.g., pBGK2)

    • Transform the construct into the target strain (e.g., ΔyidC2 mutant) for chromosomal integration at a neutral site (e.g., gtfA locus)

  • Verification approach:

    • Confirm integration by PCR using primers that span the integration site (e.g., SP17F and SP16R)

    • Verify orientation with primers positioned appropriately (e.g., SP17F-RC and SP18R)

    • Confirm conditional expression using Western blot analysis with specific antibodies under inducing and repressing conditions

  • Experimental application:

    • Culture the resulting strain in media containing different carbohydrates to modulate expression

    • For YidC2, growth in TDM-cellobiose induces expression, while TDM-mannose represses expression after 8 hours

    • Track protein levels via Western blot using YidC-specific antibodies

This approach allowed researchers to generate strain SP20, which enabled the critical finding that simultaneous elimination of both YidC1 and YidC2 is lethal in Streptococcus species .

What structural and functional insights can be gained from chimeric YidC protein studies?

Chimeric protein studies involving YidC1 and YidC2 have provided valuable insights into structure-function relationships:

  • C-terminal domain significance:

    • A chimeric YidC1 protein appended with the C-terminus of YidC2 (YidC1-C2) can complement a ΔyidC2 mutant for stress tolerance, ATP hydrolysis activity, and extracellular glyceraldehyde-3-phosphate dehydrogenase (GAPDH) activity

    • This indicates that the C-terminal domain of YidC2 contains crucial determinants for its unique functional properties

  • Experimental design for chimeric studies:

    • Construct chimeric genes encoding YidC1-C2 (YidC1 with YidC2 C-terminus) and YidC2-C1 (YidC2 with YidC1 C-terminus)

    • Integrate these constructs into appropriate chromosomal locations under controlled promoters

    • Test stress tolerance by measuring growth rates under various stress conditions (pH 5.0 for acid stress, 3% NaCl for osmotic stress)

  • Functional implications:

    • YidC1-C2 chimera restores acid tolerance to ΔyidC2 mutants comparable to wild-type YidC2 complementation

    • YidC1-C2 also partially restores salt tolerance

    • Conversely, the YidC2-C1 chimera exacerbates growth defects even under non-stress conditions, suggesting it may act as a "non-functional sink" for YidC2 substrates

  • C-terminal deletion studies:

    • YidC2 C-terminal deletion strains show similar acid and salt sensitivity to complete YidC2 deletion strains

    • Further deletion of YidC1 in a YidC2ΔC background exacerbates growth defects

These findings establish the C-terminal domain as a critical determinant of YidC2 function and suggest that specific C-terminal interactions may be essential for proper substrate recognition or functional interactions with other cellular components.

How do genomic rearrangements influence the evolution of Streptococcus pyogenes virulence factors including membrane proteins?

Genomic rearrangements play a significant role in the evolution of S. pyogenes, potentially affecting membrane protein expression and virulence:

  • Chromosomal inversion mechanisms:

    • Large-scale genomic rearrangements occur across the replication axis in S. pyogenes

    • These inversions can be mediated by homologous recombination between repeated sequences, including ribosomal operons (rrn-comX1) and prophage regions

    • In strain SSI-1 (serotype M3), approximately 1 Mb of chromosomal DNA is inverted across the replication axis compared to other GAS strains

  • Prophage-mediated recombination:

    • Streptococcal prophages represent important plasticity regions in the chromosome

    • Recombination between homologous phage genes can lead to new phage derivatives and large chromosomal rearrangements

    • Specific recombination points have been identified within phage genes, such as between holin genes and hydrase genes of different prophages

  • Temporal correlation with virulence emergence:

    • Chromosomal inversions were found in 65% of clinical isolates collected after 1990 but only 25% of isolates collected before 1985

    • This temporal correlation suggests that genomic rearrangements may contribute to the emergence of hypervirulent strains associated with severe invasive infections

  • Comparative genomic implications:

    • The X-shaped chromosomal inversion pattern has been observed between different streptococcal species, indicating that such inversions frequently occur after branching from common ancestors

    • These rearrangements may facilitate the exchange of virulence factors, including those affecting membrane protein function

Understanding these genomic dynamics provides important context for studying membrane proteins like YidC2, as their expression, regulation, and function may be influenced by larger genomic reorganization events that correlate with changes in virulence.

What strategies can be employed to study the interaction between YidC2 and its substrate proteins?

Several methodological approaches can be utilized to investigate YidC2-substrate interactions:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged YidC2 (e.g., His-tag, FLAG-tag) in S. pyogenes

    • Solubilize membranes using mild detergents that preserve protein-protein interactions

    • Perform immunoprecipitation using tag-specific antibodies

    • Identify co-precipitated proteins through mass spectrometry

    • Validate specific interactions through targeted Western blotting

  • Bacterial two-hybrid (B2H) screening:

    • Construct fusion proteins linking YidC2 to one domain of a split reporter protein

    • Create a library of potential substrate proteins fused to the complementary reporter domain

    • Screen for interactions by monitoring reporter activity (e.g., β-galactosidase)

    • Validate positive interactions through targeted mutagenesis of interaction domains

  • Site-directed crosslinking:

    • Introduce amber stop codons at specific positions in YidC2 using site-directed mutagenesis

    • Express the mutant YidC2 in the presence of a suppressor tRNA/synthetase pair that incorporates photoactivatable amino acids

    • Induce crosslinking through UV exposure

    • Identify crosslinked proteins by mass spectrometry or immunoblotting

  • Comparative proteomics of membrane fractions:

    • Isolate membrane fractions from wild-type and ΔyidC2 mutant strains

    • Analyze protein composition using quantitative proteomics approaches

    • Identify proteins with reduced membrane incorporation in the absence of YidC2

    • Validate findings through targeted approaches such as Western blotting

These approaches can be complemented by structural studies (e.g., cryo-EM) to gain insights into the molecular basis of YidC2-substrate interactions.

How can the functional redundancy and specificity between YidC1 and YidC2 be systematically investigated?

A comprehensive investigation of functional redundancy and specificity between YidC1 and YidC2 requires multiple complementary approaches:

  • Construction of a panel of mutant strains:

    • Single deletions: ΔyidC1 and ΔyidC2

    • Conditional double mutant: ΔyidC1 with conditional expression of yidC2

    • Domain-swapped chimeras: YidC1-C2 and YidC2-C1

    • Site-directed mutants of key residues in each protein

  • Comparative phenotypic profiling:

    • Growth curves under various stress conditions (pH, salt, oxidative stress)

    • Membrane integrity assays

    • Enzymatic activity measurements (ATPase, GAPDH)

    • Competence assays

    • Biofilm formation capacity

    • Virulence in appropriate animal models

  • Substrate specificity determination:

    • Quantitative proteomics comparing membrane and secreted protein profiles in each mutant

    • Pulse-chase experiments to track specific protein insertion/secretion

    • In vitro reconstitution assays with purified components

    • Suppressor screening to identify genetic interactions

  • Data integration framework:

    • Create a comprehensive table of substrates affected by each YidC protein

    • Analyze substrate characteristics (size, hydrophobicity, topology) to identify patterns

    • Correlate structural features of YidC proteins with substrate preferences

    • Develop predictive models for YidC1 versus YidC2 substrate specificity

This systematic approach would yield a detailed understanding of which functions are shared between the two insertases and which are specific to each, providing insights into the evolutionary benefit of maintaining two YidC paralogs in streptococcal species.

What methodological approaches can be used to monitor YidC2 expression and localization in real-time during infection?

Monitoring YidC2 expression and localization during infection requires sophisticated methodological approaches:

  • Fluorescent reporter systems:

    • Construct a YidC2-fluorescent protein fusion (e.g., YidC2-GFP) that maintains functionality

    • Alternatively, use a dual-reporter system with the native YidC2 and a separate fluorescent marker under the control of the yidC2 promoter

    • Validate that the fusion protein localizes correctly and complements a ΔyidC2 mutant

    • Infect appropriate cell culture models or animal models

    • Monitor expression using fluorescence microscopy or flow cytometry

  • Inducible expression systems for in vivo tracking:

    • Place YidC2 under the control of an inducible promoter (e.g., tetracycline-responsive)

    • Incorporate a readily detectable epitope tag

    • Induce expression at specific timepoints during infection

    • Detect expression through immunofluorescence or other antibody-based methods

  • Real-time PCR for transcriptional analysis:

    • Design specific primers for yidC2

    • Extract RNA from infected tissues at various timepoints

    • Perform RT-qPCR to quantify transcriptional changes

    • Compare with housekeeping genes and virulence factors to establish expression patterns

  • Tissue-specific protein extraction and analysis:

    • Infect animal models with S. pyogenes

    • Harvest tissues at different infection stages

    • Perform subcellular fractionation to isolate bacterial membranes

    • Detect YidC2 using specific antibodies via Western blotting

    • Quantify expression relative to appropriate controls

  • Single-cell analysis techniques:

    • Apply RNA-FISH (fluorescence in situ hybridization) to detect yidC2 mRNA

    • Use protein-specific antibodies for immunofluorescence

    • Combine with host cell markers to correlate YidC2 expression with specific infection stages

    • Analyze using confocal microscopy or super-resolution techniques

These methodologies provide complementary approaches to understanding the dynamics of YidC2 expression and localization during the infection process.

How does the function of YidC2 in Streptococcus pyogenes compare to its homologs in other Gram-positive pathogens?

YidC2 function exhibits both conserved and species-specific aspects across Gram-positive pathogens:

OrganismYidC HomologsEssential FunctionStress Response RoleVirulence ContributionUnique Features
S. pyogenesYidC1, YidC2Double deletion lethalYidC2 critical for acid, osmotic, oxidative stressContributes to cell surface biogenesisGenomic rearrangements may affect expression
S. mutansYidC1, YidC2Double deletion lethalYidC2 critical for acid, osmotic, oxidative stressAffects biofilm formation, cariogenicityYidC2 C-terminus functionally important
B. subtilisSpoIIIJ, YqjGAt least one requiredSpoIIIJ involved in sporulationNot a pathogenSpoIIIJ essential for sporulation
S. aureusYidC1, YidC2Double deletion lethalBoth contribute to stress toleranceAffects virulence factor secretionMore equal functional redundancy
L. monocytogenesYidC1, YidC2Double deletion lethalYidC1 more important for stressAffects intracellular survivalOpposite paralog importance

Key comparative insights include:

  • Most Gram-positive bacteria possess two YidC paralogs, unlike Gram-negative bacteria which typically have one

  • The essentiality of at least one YidC protein is conserved across species, with double deletions being lethal

  • The functional specialization between paralogs varies:

    • In S. pyogenes and S. mutans, YidC2 has more pronounced roles in stress tolerance and virulence

    • In L. monocytogenes, YidC1 appears to be functionally dominant

    • In S. aureus, the paralogs show more equal functional contributions

  • The C-terminal domain appears to be a critical determinant of functional specialization in streptococcal species, as demonstrated by chimeric protein studies

  • The role in membrane protein insertion and secretion is conserved, but the specific substrate profiles vary according to the pathogenic lifestyle of each organism

These comparative insights highlight both the conserved essential functions of YidC proteins and their adaptive specialization to specific bacterial physiological requirements.

What are the implications of YidC2 research for understanding antibiotic resistance mechanisms in Streptococcus pyogenes?

YidC2 research provides several important insights into potential antibiotic resistance mechanisms:

  • Membrane protein biogenesis and antibiotic uptake:

    • YidC2 facilitates the insertion of membrane proteins that may include antibiotic transporters or efflux pumps

    • Alterations in YidC2 function could affect the membrane proteome composition, potentially modifying antibiotic permeability or efflux capacity

    • The stress tolerance functions of YidC2 may contribute to bacterial survival during antibiotic exposure

  • Cell surface modification:

    • YidC2 contributes to cell surface biogenesis, potentially affecting the accessibility of antibiotic targets

    • Changes in cell surface composition can alter charge distribution and hydrophobicity, affecting the penetration of antimicrobial compounds

    • The altered secretion of extracellular proteins in YidC2 mutants suggests a role in modifying the bacterial surface-environment interface

  • Stress response coordination:

    • The demonstrated role of YidC2 in acid, osmotic, and oxidative stress tolerance indicates its importance in general stress adaptation

    • This stress response function may provide cross-protection against antibiotic stress

    • The connection between stress response pathways and antibiotic resistance is well-established in other bacterial species

  • Potential as a drug target:

    • The essentiality of YidC function (when both paralogs are deleted) suggests YidC2 as a potential antibiotic target

    • Compounds targeting the unique C-terminal domain of YidC2 might selectively inhibit its function

    • Since YidC is conserved across bacterial species but distinct from mammalian homologs, it represents a broad-spectrum target

  • Experimental approaches to investigate YidC2-mediated resistance:

    • Generate YidC2 variants through directed evolution under antibiotic selection

    • Compare transcriptional responses to antibiotics in wild-type versus YidC2-modified strains

    • Screen for suppressors of antibiotic sensitivity in YidC2 mutant backgrounds

Understanding how YidC2 contributes to membrane homeostasis provides valuable insights into bacterial adaptation mechanisms that may influence antibiotic susceptibility and resistance development.

How should researchers interpret conflicting results from YidC2 functional studies in different streptococcal species?

When faced with conflicting results regarding YidC2 function across streptococcal species, researchers should consider several analytical frameworks:

  • Systematic comparison of experimental conditions:

    • Compile a detailed table of methodology differences (growth conditions, media composition, strain backgrounds)

    • Evaluate how differences in experimental design might affect observed phenotypes

    • Consider whether studies examined acute versus chronic effects of YidC2 disruption

  • Evolutionary and genomic context analysis:

    • Compare genomic organization of yidC2 and surrounding regions across species

    • Analyze potential differences in regulatory elements controlling expression

    • Consider the presence of genomic rearrangements that might affect YidC2 function

    • Examine evolutionary relationships between species showing different YidC2 functions

  • Protein structure-function evaluation:

    • Compare amino acid sequences, particularly in functional domains like the C-terminus

    • Identify species-specific variations that might explain functional differences

    • Consider post-translational modifications that might vary between species

    • Evaluate potential differences in interaction partners

  • Methodological validation framework:

    • Develop standardized assays to be applied consistently across species

    • Include appropriate controls to validate methodological consistency

    • When possible, conduct parallel experiments with strains from different species

    • Consider collaborative multi-laboratory studies to validate key findings

  • Integrative data analysis approach:

    • Weight evidence based on methodological rigor and reproducibility

    • Consider whether contradictions reflect true biological differences or technical artifacts

    • Develop testable hypotheses to specifically address apparent contradictions

    • Design experiments that can distinguish between alternative explanations

By systematically addressing these aspects, researchers can determine whether conflicting results represent true biological differences in YidC2 function between streptococcal species or stem from methodological variations.

What are the common technical challenges in purifying and characterizing membrane proteins like YidC2, and how can they be overcome?

Membrane protein purification and characterization present several technical challenges:

  • Protein expression challenges:

    • Overexpression often leads to toxicity or inclusion body formation

    • Solution: Use tightly regulated inducible expression systems; optimize induction conditions (temperature, inducer concentration, duration); consider homologous expression systems

  • Membrane extraction difficulties:

    • Detergent selection is critical for maintaining structure and function

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS); use non-detergent solubilization methods like SMALPs (styrene-maleic acid lipid particles); consider native nanodiscs for functional studies

  • Purification complications:

    • Membrane proteins often aggregate during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids); maintain detergent above critical micelle concentration; use size exclusion chromatography as a final purification step; consider on-column refolding strategies

  • Functional assay limitations:

    • Difficult to maintain native lipid environment for functional studies

    • Solution: Reconstitute purified protein into proteoliposomes; develop in vitro translation/insertion assays; use fluorescence-based activity assays; establish substrate-specific activity measurements

  • Structural characterization obstacles:

    • Membrane proteins are challenging for conventional structural biology

    • Solution: Apply complementary approaches (X-ray crystallography, cryo-EM, NMR for specific domains); use molecular dynamics simulations to model membrane interactions; employ HDX-MS (hydrogen-deuterium exchange mass spectrometry) for conformational dynamics

  • Specific YidC2 purification strategy:

    • Clone yidC2 with an appropriate affinity tag (His6, Strep-tag II)

    • Express in a system lacking endogenous YidC (e.g., E. coli BL21(DE3) ΔyidC with plasmid-based complementation)

    • Induce expression at low temperature (16-18°C) overnight

    • Harvest cells and prepare membrane fraction through ultracentrifugation

    • Solubilize membranes with a mild detergent mixture (e.g., 1% DDM with 0.2% CHS)

    • Purify using affinity chromatography followed by size exclusion

    • Validate purity by SDS-PAGE and function through reconstitution assays

These methodological approaches can help overcome the significant challenges associated with purifying and characterizing membrane proteins like YidC2.

What are the promising research directions for understanding the role of YidC2 in Streptococcus pyogenes pathogenesis?

Several promising research directions will advance our understanding of YidC2's role in S. pyogenes pathogenesis:

  • Comprehensive substrate identification:

    • Apply quantitative proteomics to identify the complete repertoire of YidC2-dependent membrane and secreted proteins

    • Focus particularly on virulence factors whose membrane insertion or secretion depends on YidC2

    • Develop prediction algorithms to identify potential YidC2 substrates based on sequence features

  • Host-pathogen interaction studies:

    • Investigate how YidC2-dependent surface proteins affect adhesion to and invasion of host cells

    • Examine the role of YidC2 in immune evasion mechanisms

    • Determine whether YidC2 function is modulated during different infection stages

  • Structural biology approaches:

    • Determine the high-resolution structure of S. pyogenes YidC2, particularly focusing on the functionally important C-terminal domain

    • Compare with structures from other species to identify unique features

    • Use structure-guided mutagenesis to identify residues critical for substrate recognition

  • Investigation of genomic dynamics:

    • Further characterize the relationship between genomic rearrangements and YidC2 function/regulation

    • Determine whether chromosomal inversions affect yidC2 expression patterns

    • Explore the potential co-evolution of YidC2 with its substrate proteins

  • Therapeutic targeting strategies:

    • Develop high-throughput screening assays for compounds that inhibit YidC2 function

    • Design peptides that mimic the C-terminal domain to competitively inhibit substrate interactions

    • Explore potential for attenuated vaccine strains based on YidC2 modification

  • In vivo infection dynamics:

    • Track YidC2 expression during different stages of infection using reporter systems

    • Determine how host environments (pH, antimicrobial peptides, etc.) affect YidC2 function

    • Compare the contribution of YidC2 to pathogenesis across different infection sites (skin, throat, invasive disease)

These research directions would significantly advance our understanding of how YidC2 contributes to S. pyogenes pathogenesis and may lead to novel therapeutic strategies.

How might synthetic biology approaches be applied to engineer YidC2 for biotechnology applications?

Synthetic biology offers innovative approaches to engineer YidC2 for biotechnology applications:

  • Enhanced membrane protein production systems:

    • Engineer optimized YidC2 variants with increased capacity for membrane protein insertion

    • Develop tunable expression systems where YidC2 levels can be precisely controlled

    • Create synthetic secretion pathways incorporating engineered YidC2 for biotechnology applications

  • Substrate specificity modification:

    • Design chimeric YidC2 proteins with altered C-terminal domains to modify substrate recognition

    • Apply directed evolution to select for YidC2 variants with novel substrate preferences

    • Create YidC2 libraries with randomized key interaction residues for screening

  • Cell surface display technologies:

    • Leverage YidC2's role in membrane protein insertion to develop improved surface display platforms

    • Engineer fusion proteins combining YidC2 domains with anchor sequences for specific applications

    • Optimize surface display of enzymes, antigens, or binding proteins for biocatalysis or vaccine development

  • Biosensor development:

    • Create YidC2-based biosensors where substrate binding induces conformational changes

    • Develop reporter systems where YidC2 activity is coupled to detectable outputs

    • Design stress-responsive systems based on YidC2's role in stress tolerance

  • Minimal cell design:

    • Incorporate optimized YidC2 variants into minimal cell designs for synthetic biology applications

    • Determine the minimal components required for functional membrane protein insertion

    • Create orthogonal membrane protein insertion systems based on engineered YidC2 variants

  • Delivery system applications:

    • Develop engineered probiotics with modified YidC2 to display therapeutic proteins

    • Create cellular delivery systems where YidC2 facilitates the surface presentation of cargo molecules

    • Design bacteria with engineered YidC2 systems for vaccine delivery or environmental sensing

These synthetic biology applications would build upon our fundamental understanding of YidC2 structure and function to develop novel biotechnological tools and platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.