Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Pathogenic Relevance

SPs1599 is encoded by the SPs1599 gene in S. pyogenes M3 strain SSI-1, which was isolated from a patient with streptococcal toxic shock syndrome (STSS) . The genome of SSI-1 shares >99% identity with other M3 strains (e.g., MGAS315) but exhibits large-scale genomic rearrangements near phage integration sites . While SPs1599 is annotated as uncharacterized, its membrane localization suggests potential roles in:

  • Host-Pathogen Interactions: Membrane proteins often mediate adhesion, invasion, or evasion of host immune responses.

  • Vaccine Targets: Membrane proteins are frequently explored as antigens for vaccine development .

Research Gaps and Future Directions

Despite its isolation, SPs1599 remains poorly characterized. Key unanswered questions include:

  1. Functional Role: Does SPs1599 contribute to virulence, such as modulating host immune responses or facilitating colonization?

  2. Structural Insights: Does the protein adopt a specific fold (e.g., β-barrel, α-helical bundle) critical for membrane stability or interaction with host ligands?

  3. Cross-Serotype Conservation: Is SPs1599 unique to M3 strains or present in other S. pyogenes serotypes?

These gaps highlight the need for structural studies (e.g., X-ray crystallography) and functional assays (e.g., knockout mutants in infection models).

Comparative Analysis with Related M3 Proteins

While SPs1599 lacks direct functional data, insights can be drawn from other M3 membrane proteins:

ProteinFunctionKey FindingsSource
M3 ProteinVirulence factor, collagen bindingBinds collagen triple helices via a T-shaped domain; critical for biofilm formation
SpyCEPInterleukin-8 proteaseNeutralizes host chemokines; vaccine candidate
SCAMPsMembrane traffickingInvolved in secretion/endocytosis; conserved across kingdoms

SPs1599’s uncharacterized status contrasts with these well-studied proteins, underscoring the need for targeted research.

Applications in Research and Biotechnology

SPs1599 is primarily used in:

  • ELISA Assays: For detecting anti-S. pyogenes antibodies or studying protein interactions .

  • Structural Studies: As a template for modeling membrane protein dynamics or drug-target interactions.

  • Vaccine Development: Potential inclusion in multi-antigen formulations targeting M3 strains .

Challenges and Limitations

  1. Limited Functional Data: No peer-reviewed studies directly address SPs1599’s role in pathogenicity.

  2. Sequence Ambiguity: The absence of conserved motifs (e.g., Walker motifs, signal peptides) complicates functional predictions.

  3. Production Variability: Recombinant expression systems may yield truncated or misfolded proteins, requiring rigorous quality control .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To ensure your specified tag type, please inform us; we will prioritize its development.
Synonyms
SPs1599; Uncharacterized membrane protein SPs1599
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M3 (strain SSI-1)
Target Names
SPs1599
Target Protein Sequence
MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND
Uniprot No.

Target Background

Database Links

KEGG: sps:SPs1599

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of SPs1599 in Streptococcus pyogenes serotype M3?

SPs1599 is a protein-coding gene found in the genome of Streptococcus pyogenes serotype M3 strain SSI-1. The SSI-1 genome consists of 1,884,275 bp with a G+C content of 37.93% . Genomic analyses indicate that approximately 85.94% of the genome is coding, with 1,861 protein-coding regions and an average gene length of 853 bp . The genomic context of SPs1599 can be better understood through comparative genomics with other serotypes. The M3 serotype has been particularly associated with severe invasive infections and streptococcal toxic-shock like syndrome (STSS) .

When examining SPs1599, researchers should analyze flanking regions to identify potential operons or gene clusters that might suggest functional relationships. Comparative analysis with strain MGAS315 (another M3 strain) would be particularly valuable, as these strains show remarkable conservation with an average of only 0.05 SNPs per gene .

How do I clone the SPs1599 gene for recombinant expression studies?

To clone the SPs1599 gene for recombinant expression, you can adapt approaches similar to those used for other S. pyogenes proteins like SpeB . A methodological approach would include:

  • Primer design based on the genomic sequence of SPs1599 from the SSI-1 strain, including appropriate restriction sites for directional cloning (such as NdeI and StuI used for other GAS genes) .

  • PCR amplification of the full-length gene, excluding the native secretion signal sequence if membrane expression is not desired.

  • Restriction digestion and ligation into an appropriate expression vector. For example, the pPROEX-1 vector has been successfully used for other S. pyogenes proteins .

  • Transformation into a suitable E. coli strain such as DH5α, followed by selection on media containing appropriate antibiotics (e.g., ampicillin at 100 μg/ml) .

  • Verification of the construct by restriction analysis and automated DNA sequence analysis to ensure the correct reading frame and absence of spurious mutations .

For membrane proteins like SPs1599, consider vectors with fusion tags that aid in solubilization and purification, such as His-tags, which have proven effective for other streptococcal proteins .

What expression systems are suitable for recombinant production of SPs1599?

For the expression of a membrane protein like SPs1599, several expression systems can be considered:

  • E. coli expression systems: While E. coli DH5α has been successfully used for other GAS proteins , membrane proteins often require specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Gram-positive expression systems: Using Bacillus subtilis or other Gram-positive hosts may provide a more suitable membrane environment for proper folding, especially important since SPs1599 naturally exists in a Gram-positive context.

  • Cell-free expression systems: These can be advantageous for membrane proteins as they allow direct incorporation into artificial membranes or nanodiscs.

  • Eukaryotic expression systems: For complex membrane proteins, yeast (Pichia pastoris, Saccharomyces cerevisiae) or insect cell systems may provide better post-translational modifications.

The choice depends on research goals. For structural studies, an E. coli system with fusion partners like the ones used for SpeB recombinant proteins might be suitable . For functional studies, preserving native conformation using a Gram-positive host could be preferable.

How can I verify the expression of recombinant SPs1599?

Verification of SPs1599 expression can be accomplished through multiple complementary methods:

  • SDS-PAGE analysis: To visualize the expressed protein at the expected molecular weight.

  • Western blotting: Using antibodies against the fusion tag (e.g., His-tag) or developing specific antibodies against SPs1599.

  • Mass spectrometry: For confirmation of protein identity and analysis of post-translational modifications.

  • Immunological reactivity: If antibodies are available, ELISA or other immunoassays can confirm expression, similar to approaches used for SpeB where both polyclonal and monoclonal antibodies were employed .

  • Functional assays: If the function becomes known, specific activity assays can verify not just expression but functional integrity.

Remember that membrane proteins may require specialized extraction methods using detergents or other solubilizing agents before analysis.

How can I determine if SPs1599 contributes to virulence in Streptococcus pyogenes serotype M3?

Investigating the potential role of SPs1599 in virulence requires a multifaceted approach:

  • Gene knockout studies: Create isogenic strains with SPs1599 deletions using recombinant DNA strategies similar to those used for SpeB virulence studies . Compare wild-type and knockout strains in:

    • Animal infection models (e.g., mouse models of invasive disease)

    • Cell adhesion and invasion assays

    • Immune evasion studies

    • Biofilm formation tests

  • Complementation studies: Reintroduce the wild-type gene to confirm that observed phenotypes are directly attributable to SPs1599.

  • Expression analysis: Determine if SPs1599 expression is upregulated during infection using RT-PCR or RNA-seq approaches.

  • Human serological studies: Analyze whether patients with invasive S. pyogenes infections seroconvert to SPs1599, similar to studies with SpeB , which would indicate in vivo expression during infection.

  • Protein interaction studies: Identify host cell components that interact with SPs1599, suggesting mechanisms of action.

This comprehensive approach will help determine whether SPs1599 is a critical virulence factor similar to the cysteine protease SpeB, which has been unambiguously documented as important in mouse models of invasive disease .

What structural features of SPs1599 might suggest its function?

For an uncharacterized membrane protein like SPs1599, structural analysis can provide insights into function:

  • Bioinformatic analysis: Begin with sequence-based predictions:

    • Transmembrane domain prediction using tools like TMHMM or Phobius

    • Identification of conserved domains using Pfam, SMART, or CDD

    • Sequence similarity searches against characterized proteins

    • Secondary structure prediction

  • Experimental structural determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly used for membrane proteins)

    • NMR for smaller domains or fragments

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Topology mapping: Determine the orientation in the membrane using approaches like:

    • Reporter fusion constructs

    • Protease accessibility studies

    • Immunolabeling of epitope tags

  • Comparative analysis with homologs: Examine if structural features are conserved across different streptococcal strains or species.

The absence of characterized homologs may necessitate de novo structural determination, which remains challenging for membrane proteins but can provide crucial functional insights.

How does genomic variation in SPs1599 compare across different clinical isolates of S. pyogenes M3?

Understanding genomic variation requires comparative genomic analysis:

  • Single Nucleotide Polymorphism (SNP) analysis: Compare the SPs1599 sequence across multiple M3 isolates, noting both synonymous and non-synonymous SNPs. Based on data from other serotype M3 comparisons, you might expect relatively few SNPs if SPs1599 is highly conserved (similar to the average 0.05 SNPs per gene observed between SSI-1 and MGAS315 strains) .

  • Distribution analysis: Determine if SPs1599 is present in all M3 isolates or only a subset, which might indicate horizontal gene transfer or gene loss events.

  • Selective pressure analysis: Calculate dN/dS ratios to determine if SPs1599 is under positive, negative, or neutral selective pressure.

  • Temporal analysis: Compare historical versus recent isolates to identify evolutionary trends, similar to observations about chromosomal inversions that became more frequent after 1985 .

  • Cross-serotype comparison: Determine if SPs1599 homologs exist in other serotypes and how they differ, considering that 1.7 Mb of the SSI-1 sequence is highly conserved relative to other serotypes including M1 (SF370) and M18 (MGAS8232) .

This comprehensive analysis can reveal whether SPs1599 is part of the core genome of M3 strains or represents strain-specific adaptations potentially related to virulence.

How can I determine if SPs1599 is expressed in vivo during human infections?

To establish in vivo expression during human infections:

  • Serological studies: Test convalescent sera from patients with S. pyogenes M3 infections for antibodies against recombinant SPs1599, similar to approaches used with SpeB . Seroconversion would provide strong evidence for in vivo expression, as demonstrated with SpeB where patients with diverse invasive disease episodes seroconverted to the streptococcal cysteine protease .

  • Transcriptomic approaches: Analyze S. pyogenes RNA directly from clinical samples using:

    • RT-PCR targeting SPs1599 mRNA

    • RNA-seq of bacteria isolated from infection sites

    • In situ hybridization on tissue samples

  • Proteomics: Direct detection of SPs1599 protein in clinical samples using:

    • Mass spectrometry-based proteomics

    • Immunohistochemistry if specific antibodies are available

  • Animal model validation: Confirm expression patterns in animal models of infection to support human findings.

Evidence of in vivo expression would provide justification for further functional characterization and potentially identify SPs1599 as a diagnostic marker or therapeutic target.

What are the key considerations for designing site-directed mutagenesis experiments for SPs1599?

Effective site-directed mutagenesis requires strategic planning:

For transmembrane proteins, particular attention should be paid to mutations in predicted membrane-spanning regions, as these can disrupt membrane insertion and folding rather than just affecting specific functions.

How can I design experiments to study protein-protein interactions involving SPs1599?

To investigate protein-protein interactions of a membrane protein like SPs1599:

  • Pull-down assays: Use recombinant SPs1599 with affinity tags to identify interacting partners from:

    • Host cell lysates to identify host targets

    • Bacterial lysates to identify bacterial interaction partners

  • Bacterial two-hybrid systems: Particularly those adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid).

  • Split-GFP complementation: Can visualize interactions in living cells when proteins are in proximity.

  • Co-immunoprecipitation: If specific antibodies are available or using tagged versions of SPs1599.

  • Surface plasmon resonance (SPR): For quantitative assessment of binding kinetics with purified potential partners.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry identification to capture transient interactions.

For membrane proteins like SPs1599, consider using methods that preserve the membrane environment, such as nanodiscs or detergent micelles, to maintain native conformation during interaction studies.

What approaches can be used to study the localization of SPs1599 in S. pyogenes cells?

Understanding the precise localization of SPs1599 requires multiple complementary approaches:

  • Fluorescent protein fusions: Create translational fusions with fluorescent proteins, being careful to avoid disrupting localization signals.

  • Immunofluorescence microscopy: Using antibodies specific to SPs1599 or epitope tags.

  • Cell fractionation: Separate membrane fractions (cytoplasmic membrane vs. cell wall) followed by Western blotting.

  • Protease accessibility assays: To determine which portions of the protein are exposed on the cell surface.

  • Immunogold electron microscopy: For high-resolution localization studies.

  • Super-resolution microscopy techniques: Such as STORM or PALM for detailed localization beyond the diffraction limit.

For membrane proteins, special attention should be paid to distinguishing between cytoplasmic membrane localization versus potential association with the cell wall or extracellular structures, particularly important for understanding potential roles in host-pathogen interactions.

How should I analyze sequence conservation of SPs1599 across different streptococcal species?

Comprehensive sequence conservation analysis involves several steps:

  • Homolog identification:

    • Perform BLAST/PSI-BLAST searches against streptococcal genomes

    • Use profile-based methods (HMMer) for remote homolog detection

    • Consider structural homologs that may not be evident from sequence alone

  • Multiple sequence alignment (MSA):

    • Use algorithms optimized for membrane proteins (e.g., MAFFT with appropriate gap penalties)

    • Manually refine alignments, particularly in transmembrane regions

    • Visualize conservation patterns using tools like Jalview or WebLogo

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Compare SPs1599 phylogeny to species phylogeny to detect horizontal gene transfer

    • Identify lineage-specific adaptations

  • Conservation metrics:

    • Calculate positional conservation scores

    • Identify invariant residues across all species

    • Map conservation onto predicted structural models

  • Comparative genomics:

    • Analyze synteny (gene order conservation) around SPs1599

    • Examine if SPs1599 is part of the core genome or accessory genome

What statistical approaches are appropriate for analyzing virulence differences between wild-type and SPs1599 mutant strains?

Rigorous statistical analysis is crucial for virulence studies:

  • Experimental design considerations:

    • Ensure adequate sample sizes based on power analysis

    • Include appropriate controls (wild-type, complemented mutant)

    • Randomize experimental units to control for confounders

    • Consider blocking designs to account for batch effects

  • Statistical methods for in vitro studies:

    • For continuous outcomes: ANOVA or t-tests with appropriate corrections for multiple comparisons

    • For count data: Poisson or negative binomial regression

    • For time-to-event data: Survival analysis with log-rank tests

  • Statistical methods for in vivo studies:

    • Survival analysis using Kaplan-Meier curves and log-rank tests

    • Mixed effects models for repeated measures

    • Nonparametric methods for non-normally distributed data

  • Advanced analyses:

    • Multivariate approaches to examine multiple outcomes simultaneously

    • Bayesian methods for incorporating prior knowledge

    • Meta-analysis if combining multiple experimental replicates

  • Reporting standards:

    • Report effect sizes with confidence intervals, not just p-values

    • Clearly describe all statistical tests used and assumptions tested

    • Use appropriate visualizations (e.g., box plots, survival curves)

Proper statistical analysis ensures that reported virulence differences can be confidently attributed to SPs1599 mutation rather than random variation.

How can I interpret comparative genomic data for SPs1599 in the context of S. pyogenes evolution?

Comparative genomic analysis requires systematic investigation:

  • Genomic context analysis:

    • Examine conservation of gene neighborhoods across strains

    • Identify if SPs1599 is located in core genome regions or mobile genetic elements

    • Determine if it's near known virulence factors or pathogenicity islands

  • Phylogenetic profiling:

    • Map presence/absence of SPs1599 across a phylogenetic tree of streptococci

    • Correlate with phenotypic traits (e.g., invasiveness, tissue tropism)

    • Identify co-evolving genes that may functionally interact with SPs1599

  • Evolutionary pattern analysis:

    • Calculate dN/dS ratios to detect selective pressure

    • Identify recombination events using methods like ClonalFrameML

    • Examine if SPs1599 shows evidence of horizontal gene transfer

  • Correlation with genomic rearrangements:

    • Determine if SPs1599 is involved in or affected by chromosomal inversions observed in M3 strains

    • Assess if it's located near phage integration sites or other mobile elements, noting that in SSI-1, phages SPsP5 and SPsP6 are integrated at positions equidistant from the ter region

  • Temporal analysis:

    • Compare historical versus recent isolates

    • Correlate with changes in disease patterns, considering that isolation frequency of clinical isolates with chromosomal inversion increased after 1985

This approach can contextualize SPs1599 within the broader evolutionary history of S. pyogenes and potentially link specific genetic variations to clinical presentations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.