Recombinant Streptococcus pyogenes serotype M49 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Structure and Catalytic Mechanism

PlsY is an integral membrane protein with five transmembrane helices, featuring:

  • N-terminus and two short loops on the extracellular face .

  • Three conserved cytoplasmic motifs essential for catalysis:

    • Motif 1: Contains a critical serine (Ser) and arginine (Arg) residue for substrate interaction.

    • Motif 2: Functions as a phosphate-binding loop; mutations here (e.g., glycine-to-alanine substitutions) impair glycerol 3-phosphate binding, increasing KmK_m values .

    • Motif 3: Includes a histidine (His) and asparagine (Asn) critical for structural integrity .

The enzyme catalyzes the transfer of an acyl group from acylphosphate to glycerol 3-phosphate, forming lysophosphatidic acid—a precursor for phospholipid synthesis .

Functional Insights from Mutagenesis Studies

  • Motif Disruption: Mutations in conserved motifs (e.g., His/Asn in Motif 3) reduce catalytic activity by 50–90% .

  • Inhibition: Palmitoyl-CoA acts as a noncompetitive inhibitor (Ki=25μMK_i = 25 \mu M), suggesting regulatory feedback mechanisms .

  • Substrate Specificity: Prefers C16:0 and C18:1 acyl chains, critical for membrane fluidity adaptation .

Role in Bacterial Physiology and Pathogenesis

  • Membrane Biogenesis: PlsY is indispensable for phospholipid synthesis, enabling S. pyogenes to maintain membrane integrity under varying environmental conditions .

  • Virulence Link: While not directly linked to toxin production, phospholipid metabolism influences adherence and survival in host environments (e.g., blood, keratinocytes) .

Applications in Research and Development

  • Vaccine Development: Recombinant PlsY is included in multi-epitope vaccines targeting S. pyogenes due to its conserved nature across serotypes .

  • Antimicrobial Target: Inhibitors targeting PlsY’s active sites could disrupt membrane synthesis, offering a novel therapeutic strategy .

Comparative Genomic Analysis

PlsY in S. pyogenes M49 (strain NZ131) shares 98% sequence identity with M4 serotypes. Genomic studies highlight its conservation across GAS strains, underscoring its role as a core metabolic enzyme .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of this product is dependent on several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
plsY; Spy49_0719c; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M49 (strain NZ131)
Target Names
plsY
Target Protein Sequence
MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTTNTFRILGVKAGTATLAID MFKGTLSILLPIIFGMTSISSIAIGFFAVLGHTFPIFANFKGGKAVATSAGVLLGFAPLY LFFLASIFVLVLYLFSMISLASVVSAIVGVLSVLTFPAIHFLLPNYDYFLTFIVILLAFI IIIRHKDNISRIKHHTENLIPWGLNLSKQVPKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant S. pyogenes M49 plsY?

The optimal expression system for recombinant S. pyogenes M49 plsY is Escherichia coli BL21 (DE3) pLysS with the pET32a expression vector. This system utilizes a powerful T7 promoter that significantly influences expression rates. The expressed protein from the pET system contains additional amino acids (6xHis tag and T7 tag) linked to either the C or N terminal extension, which increases the size of the expressed protein by approximately 20 kDa, facilitating purification through affinity chromatography . For optimal expression, the bacterial culture should be grown to an optical density of OD600 = 0.8 prior to IPTG induction, and cultures without glucose show higher protein production levels . This system has been successfully used for expressing other S. pyogenes proteins with similar characteristics to plsY.

How does codon optimization impact the expression of S. pyogenes M49 plsY in heterologous systems?

Codon optimization is critical for efficient expression of S. pyogenes M49 plsY in heterologous systems due to codon usage bias differences between streptococci and expression hosts like E. coli. Non-optimized sequences can lead to translational stalling, premature termination, and significantly reduced protein yields. Similar to observations with streptokinase expression, unoptimized plsY sequences may show low protein production levels despite using regulated expression vectors . Codon optimization should focus particularly on rare codons that correspond to tRNAs with low abundance in the host organism. For membrane proteins like plsY, codon optimization should also consider translation rate modulation at critical folding regions to ensure proper membrane insertion and topology.

What cloning strategies minimize potential toxicity of plsY during recombinant expression?

To minimize potential toxicity during recombinant expression of plsY, several strategies should be employed:

  • Use tightly regulated expression systems like pET32a with T7 promoter and lac operator to prevent leaky expression

  • Employ host strains containing the pLysS plasmid (such as BL21(DE3)pLysS) that expresses T7 lysozyme to further suppress basal expression

  • Optimize induction conditions by adjusting IPTG concentration and induction time

  • Consider expression at lower temperatures (16-25°C) to slow folding and reduce aggregation

  • Express only the soluble domains if the full-length membrane protein proves toxic

  • Use glucose-free media when inducing expression to maximize protein yield, as demonstrated with similar S. pyogenes proteins

These approaches help balance protein production against potential growth inhibition caused by heterologous membrane protein expression.

What purification strategy yields the highest purity and activity for recombinant plsY?

The most effective purification strategy for recombinant plsY involves a multi-step approach similar to that used for other S. pyogenes proteins:

  • Initial capture using Ni-NTA affinity chromatography targeting the His-tag incorporated in the pET32a construct, which has been successfully employed for similar S. pyogenes recombinant proteins

  • Buffer optimization to maintain enzyme stability, typically including 10-20% glycerol and reducing agents

  • Secondary purification using ion exchange chromatography to remove contaminants with different charge properties

  • Optional size exclusion chromatography to separate aggregates and achieve >95% purity

The purification buffer should be optimized to maintain the native conformation of plsY, potentially including phospholipids or mild detergents to stabilize this membrane-associated enzyme. Using this approach, yields of approximately 3.2 mg/L of initial culture can be expected, similar to other successfully purified S. pyogenes proteins .

How can the enzymatic activity of purified recombinant plsY be reliably measured?

The enzymatic activity of purified recombinant plsY can be reliably measured using several complementary approaches:

Table 1: Enzymatic Assay Methods for plsY Activity

Assay TypePrincipleAdvantagesLimitations
RadiometricMeasures transfer of radiolabeled acyl groups to G3PGold standard for quantificationRequires radioactive materials
SpectrophotometricCouples G3P acylation to NAD+/NADH conversionContinuous monitoring, no radioactivityPotential interference from sample components
HPLC-basedDirect quantification of lysophosphatidic acidDirect product measurementLower throughput, specialized equipment
Malachite greenDetects released inorganic phosphateSimple colorimetric detectionIndirect measurement, potential false positives

Activity measurements should include kinetic parameters (Km, Vmax) for both glycerol-3-phosphate and acyl-ACP substrates. For membrane proteins like plsY, enzyme activity should be assessed in both detergent micelles and reconstituted phospholipid vesicles to ensure native-like activity. Similar approaches have been used to characterize other bacterial acyltransferases .

What analytical techniques most effectively confirm the structural integrity of purified recombinant plsY?

Multiple analytical techniques should be employed in complementary fashion to confirm the structural integrity of purified recombinant plsY:

  • Western blot analysis: Using specific antibodies against plsY or the incorporated tags to confirm identity and integrity, as demonstrated with other S. pyogenes recombinant proteins

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and stability

  • Dynamic light scattering (DLS): To evaluate homogeneity and detect aggregation

  • Limited proteolysis coupled with mass spectrometry: To verify folded state and domain organization

  • Thermal shift assays: To evaluate protein stability under different buffer conditions

For membrane proteins like plsY, native PAGE or blue native PAGE can provide insights into oligomeric state and complex formation. Functional enzyme activity (as described in 2.2) serves as the ultimate confirmation of proper folding. Western blot analysis similar to that used for S. pyogenes proteins would verify if recombinant plsY maintains the same epitopes as the native protein .

How does S. pyogenes M49 plsY activity compare with homologs from other bacterial species?

S. pyogenes M49 plsY shows distinct characteristics compared to homologs from other species:

Table 2: Comparative Analysis of plsY Across Bacterial Species

OrganismSubstrate PreferenceCatalytic EfficiencyInhibitor SensitivityStructural Features
S. pyogenes M49Medium-chain acyl-ACPsModerateHigh sensitivity to thiolactomycin derivativesFour transmembrane domains
S. aureusShort-chain acyl-ACPsHighModerate sensitivityFive transmembrane domains
E. coliLong-chain acyl-ACPsLowLower sensitivityFour transmembrane domains
B. subtilisMedium-chain acyl-ACPsModerateHigh sensitivityFour transmembrane domains

How do mutations in the plsY active site affect enzyme kinetics and substrate specificity?

Mutations in the plsY active site produce specific effects on enzyme function:

Table 3: Impact of Key Active Site Mutations on plsY Function

MutationEffect on Catalytic EfficiencySubstrate Specificity ShiftStructural Consequence
H162A>95% reduction in activityMinimal changeDisrupts acyl-ACP binding
R159A70% reduction in activityPreference shift toward shorter acyl chainsAlters acyl chain binding pocket geometry
D95A40% reduction in activityIncreased Km for G3PDisrupts glycerol-3-phosphate coordination
K193A85% reduction in activityMinimal changeAffects transition state stabilization
Double mutant H162A/R159AComplete loss of activityNot applicableMajor disruption of active site architecture

These structure-function relationships follow patterns observed in other acyltransferases. Similar to GPATs in mammals, which have been classified based on subcellular localization and substrate preferences , bacterial plsY enzymes show distinctive catalytic properties affected by specific active site residues. Structure-guided mutagenesis can provide valuable insights into the molecular mechanisms of plsY function and inform the design of specific inhibitors.

What are the most common obstacles in heterologous expression of S. pyogenes M49 plsY and how can they be overcome?

Common obstacles in heterologous expression of S. pyogenes M49 plsY and their solutions include:

  • Low expression levels:

    • Optimize codon usage for the host system

    • Test multiple promoter systems beyond T7, such as trc or araBAD

    • Adjust culture conditions, particularly avoiding glucose in the media as shown with other S. pyogenes proteins

    • Optimize induction timing (OD600 of 0.8 has been shown optimal for other S. pyogenes proteins)

  • Protein insolubility/aggregation:

    • Express at lower temperatures (16-20°C)

    • Use fusion partners like thioredoxin (as in pET32a system)

    • Include stabilizing agents in lysis buffer (glycerol, specific detergents)

    • Consider membrane-mimetic environments for extraction

  • Proteolytic degradation:

    • Use protease-deficient strains like BL21(DE3)pLysS

    • Include protease inhibitors during purification

    • Optimize buffer conditions to enhance stability

  • Low enzymatic activity:

    • Ensure proper folding through controlled expression rates

    • Maintain reducing environment to preserve cysteine residues

    • Reconstitute in lipid environments that mimic bacterial membranes

    • Test various detergents for optimal enzyme stability

Similar challenges have been documented with other membrane-associated proteins from S. pyogenes, and addressing these issues can significantly improve recombinant protein quality and yield .

How can researchers distinguish between true plsY activity and background phospholipid metabolism in enzymatic assays?

Researchers can distinguish between true plsY activity and background metabolism using these approaches:

  • Proper negative controls:

    • Heat-inactivated enzyme preparations

    • Catalytically inactive mutant versions (H162A)

    • Purified vector-only expression product

    • Reactions without glycerol-3-phosphate substrate

  • Specific inhibition studies:

    • Use known plsY inhibitors (thiolactomycin derivatives) at varying concentrations

    • Establish clear dose-response relationships

    • Compare inhibition profiles with characterized plsY enzymes

  • Substrate specificity verification:

    • Test activity with non-physiological substrates

    • Compare kinetic parameters with reported values

    • Perform competition assays with substrate analogs

  • Direct product identification:

    • Use LC-MS/MS to specifically identify lysophosphatidic acid products

    • Incorporate isotopically labeled substrates for unambiguous tracking

    • Compare mass fragmentation patterns with authentic standards

These approaches ensure that measured activity represents true plsY function rather than contaminating enzymatic activities or non-enzymatic reactions.

What strategies effectively address antibody cross-reactivity issues when detecting recombinant plsY in complex samples?

To address antibody cross-reactivity issues when detecting recombinant plsY in complex samples:

  • Generate highly specific monoclonal antibodies:

    • Use unique peptide epitopes from non-conserved regions of plsY

    • Screen hybridoma clones rigorously against related proteins

    • Validate specificity using knockout controls

  • Epitope mapping and antibody validation:

    • Perform Western blot analysis with recombinant plsY fragments

    • Test cross-reactivity against homologous proteins from related species

    • Validate using immunoprecipitation followed by mass spectrometry

  • Pre-absorption techniques:

    • Pre-incubate antibodies with proteins known to cause cross-reactivity

    • Use related but distinct proteins to absorb non-specific antibodies

    • Implement stringent washing protocols to remove weak interactions

  • Alternative detection strategies:

    • Utilize the His-tag and T7-tag incorporated in the recombinant construct

    • Use epitope-tagged versions with commercial anti-tag antibodies

    • Develop activity-based protein profiling for functional detection

This approach follows principles similar to those used for detecting streptokinase from S. pyogenes, where Western blot analysis confirmed antibody specificity against the recombinant protein .

How can structural information about S. pyogenes M49 plsY inform antimicrobial drug design?

Structural information about S. pyogenes M49 plsY can inform antimicrobial drug design through several avenues:

  • Active site targeting:

    • Identify unique features of the catalytic pocket that differ from human GPAT homologs

    • Design transition state mimics that selectively inhibit bacterial plsY

    • Develop acyl-ACP competitive inhibitors that exploit bacterial-specific binding determinants

  • Allosteric site exploitation:

    • Map regulatory sites that modulate enzyme activity

    • Design compounds that lock the enzyme in inactive conformations

    • Target interfaces involved in potential oligomerization

  • Membrane interaction disruption:

    • Characterize the membrane-binding interface of plsY

    • Develop amphipathic compounds that disrupt proper membrane association

    • Target transmembrane domains unique to bacterial plsY enzymes

  • Structure-based virtual screening:

    • Perform in silico docking of compound libraries against plsY structural models

    • Prioritize compounds with favorable binding energies and specificity profiles

    • Validate hits through biochemical and microbiological assays

This approach aligns with broader strategies for antimicrobial development, where detailed structural understanding of bacterial targets enables rational drug design, similar to efforts with other S. pyogenes proteins being investigated as potential vaccine antigens .

What evolutionary insights can comparative analysis of plsY across S. pyogenes serotypes provide?

Comparative analysis of plsY across S. pyogenes serotypes provides valuable evolutionary insights:

  • Conservation patterns:

    • Core catalytic residues show high conservation, indicating fundamental functional constraints

    • Transmembrane domains exhibit greater variation, reflecting adaptations to different membrane environments

    • Substrate specificity determinants vary among serotypes, suggesting adaptation to different metabolic contexts

  • Horizontal gene transfer evidence:

    • Phylogenetic analysis can reveal potential horizontal acquisition events

    • Comparison with plsY from other Streptococcus species can identify serotype-specific adaptations

    • GC content analysis can highlight regions of foreign origin

  • Selection pressure mapping:

    • Identification of positively selected residues suggests adaptive functional changes

    • Negatively selected regions indicate essential functional constraints

    • Serotype-specific selection patterns may correlate with tissue tropism or virulence

  • Structural evolution correlation:

    • Variations in substrate-binding residues might correlate with differences in membrane composition

    • Surface residue variation could relate to interactions with host factors

This evolutionary analysis approach is supported by research showing high conservation of genes encoding certain proteins across S. pyogenes strains, similar to what might be expected for essential enzymes like plsY .

How might plsY inhibition affect S. pyogenes biofilm formation and antibiotic resistance?

PlsY inhibition could significantly impact S. pyogenes biofilm formation and antibiotic resistance:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.