Thymidylate kinase (tmk) is a conserved enzyme critical for DNA synthesis, catalyzing the phosphorylation of thymidine monophosphate (dTMP) to thymidine diphosphate (dTDP). In bacterial pathogens like S. pyogenes, nucleotide biosynthesis pathways are essential for replication and virulence. While tmk is not highlighted in the provided studies, homologs in other streptococci are known to interact with metabolic and regulatory networks .
The production of recombinant proteins in S. pyogenes M49 often involves genetic manipulation techniques such as plasmid-based deletion/insertion systems (e.g., pUC18Erm1, pFW11) . For example:
GPSB Recombinant Protein: Source describes a recombinant protein (UniProt ID: B5XMJ7) from S. pyogenes M49, though its annotation does not specify tmk.
| Parameter | Description |
|---|---|
| Protein Name | GPSB Recombinant Protein (UniProt ID: B5XMJ7) |
| Sequence | MTSIIYSPKDIFEQEFKTSMRGFDKKEVDEFLDNVIKDYENFNAQIEALKAENEALKKAKYQARNTVSATVQQPVPQPTRVAQSATNFDILKRISKLEKEVFGKQIIE |
| Applications | WB, ELISA |
| Purity | >85% (SDS-PAGE) |
| Storage | Tris-based buffer, 50% glycerol |
Although tmk is not discussed, other kinases and metabolic regulators in S. pyogenes M49 provide context:
SP-TyK: A dual-specificity tyrosine kinase regulating cell division, virulence, and phosphorylation of CovR/WalR .
MsmR: Transcriptional regulator influencing metabolic and virulence genes .
Nudix Hydrolase: A nucleotide-metabolizing enzyme specific to M49/M82 strains, linked to survival in variable environments .
To study recombinant tmk in S. pyogenes M49:
Genomic Analysis: Query the M49 genome (e.g., strain NZ131 ) for tmk homologs (gene ID: spy_xxxx).
Cloning Strategies: Use plasmids like pUC18Erm1 or pFW11 for gene knockout/complementation.
Functional Assays: Assess enzymatic activity via phosphorylation assays (e.g., TLC or HPLC) .
KEGG: soz:Spy49_0326