Recombinant Streptococcus pyogenes serotype M5 Elongation factor Ts (tsf)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Sequence

The recombinant TSF protein (UniProt ID: A2RGT0) consists of 346 amino acids with the following sequence :

PositionSequence
1-346MAEITAKLVKELREKSGAGVMDAKKALVETDGDMDKAVELLREKGMAKAAKKADRVAAEGLTGVYVHGNVAAVVEVNAETDFVAKNAQFVELVNATAKVIAEGKPANNDEALALVMPSGETLAEAYVNATATIGEKISFRRFALIEKTDEQHFGAYQHNGGRIGVISVVEGGDDALAKQVSMHIAAMKPTVLSYTELDAQFIKDELAQLNHAIELDNESRAMVDKPALPFLKYGSKAQLSDDVITAAEADIKAELAAEGKPEKIWDKIIPGKMDRFMLDNTKVDQAYTLLAQVYIMDDSKTVEAYLDSVNAKAIAFARFEVGEGIEKKANDFESEVAATMAAALNN

Key biophysical properties:

  • Molecular weight: Calculated based on sequence

  • Purity: >85% (verified by SDS-PAGE)

  • Buffer: Tris-based formulation with 50% glycerol

  • Storage: Stable for 6 months at -20°C/-80°C in liquid form

Biological Context in S. pyogenes

While elongation factor Ts serves a housekeeping role in protein synthesis, S. pyogenes serotype M5 also produces the well-characterized M5 virulence protein. Studies show M5 contains three functional domains :

  1. Hypervariable Region (HVR): Essential for acute infection in murine models

  2. B-repeat region: Binds fibrinogen and confers phagocytosis resistance

  3. C-repeat region: Binds albumin with minor virulence contribution

Notably, M5 protein preparations were historically associated with mitogenic activity due to contamination by superantigens like SPE-C, rather than intrinsic properties . This distinction highlights the importance of rigorous protein purification – a standard adhered to in modern recombinant production methods like those used for TSF .

Quality Control and Usage Considerations

The recombinant TSF protein undergoes stringent quality assessments:

  • Purity verification: SDS-PAGE analysis

  • Functional validation: Batch-specific activity testing

  • Customization options: Sterile filtration and alternative buffer formulations

Researchers should note that while this recombinant protein enables study of S. pyogenes translation mechanisms, its production strain (Escherichia coli) lacks post-translational modifications native to streptococcal systems .

Research Implications

This reagent facilitates:

  • Antibody production against S. pyogenes translational machinery

  • Functional studies of bacterial protein synthesis inhibitors

  • Comparative analyses of elongation factor conservation across streptococcal serotypes

Product Specs

Form
Lyophilized powder. We will ship the in-stock format preferentially. If you have specific format requirements, please note them when ordering.
Lead Time
Delivery times vary by purchase method and location. Consult your local distributor for specific delivery times. All proteins are shipped with standard blue ice packs. Request dry ice in advance for an extra fee.
Notes
Avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute the protein in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer components, storage temperature, and protein stability. Liquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon arrival. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tsf; SpyM51740Elongation factor Ts; EF-Ts
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Streptococcus pyogenes serotype M5 (strain Manfredo)
Target Names
tsf
Target Protein Sequence
MAEITAKLVK ELREKSGAGV MDAKKALVET DGDMDKAVEL LREKGMAKAA KKADRVAAEG LTGVYVHGNV AAVVEVNAET DFVAKNAQFV ELVNATAKVI AEGKPANNDE ALALVMPSGE TLAEAYVNAT ATIGEKISFR RFALIEKTDE QHFGAYQHNG GRIGVISVVE GGDDALAKQV SMHIAAMKPT VLSYTELDAQ FIKDELAQLN HAIELDNESR AMVDKPALPF LKYGSKAQLS DDVITAAEAD IKAELAAEGK PEKIWDKIIP GKMDRFMLDN TKVDQAYTLL AQVYIMDDSK TVEAYLDSVN AKAIAFARFE VGEGIEKKAN DFESEVAATM AAALNN
Uniprot No.

Target Background

Function
Associates with the EF-Tu.GDP complex and promotes GDP to GTP exchange. Remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex until GTP hydrolysis on the ribosome.
Database Links
Protein Families
EF-Ts family
Subcellular Location
Cytoplasm.

Q&A

What is the genomic context of the tsf gene in Streptococcus pyogenes serotype M5?

The tsf gene in S. pyogenes serotype M5 encodes Elongation factor Ts, a critical protein for bacterial translation. While the search results don't specifically discuss the tsf genomic context, molecular cloning studies of S. pyogenes M5 have demonstrated that careful mapping of genomic regions is essential for properly identifying and isolating functional genes. Similar to the approach used for the M5 protein gene (smp5), the tsf gene can be mapped and its transcriptional orientation determined through subcloning into E. coli plasmid vectors, followed by characterization using deletion and transposon insertion mutants . Genetic analysis should include Southern blotting with gene-specific probes to identify any potential homologous sequences in the genome, as was observed with the smp5 gene which had multiple copies sharing homology within the type 5 group A streptococcal genome .

How does Streptococcus pyogenes serotype M5 Elongation factor Ts (tsf) differ structurally from tsf proteins in other bacterial species?

Elongation factor Ts in S. pyogenes serotype M5 serves the conserved function of regenerating EF-Tu during protein synthesis, but may contain species-specific structural features. While the search results don't directly address structural differences, proteomic approaches similar to those used for identifying surface-associated proteins can be applied to characterize tsf . Structural analysis would require protein purification followed by techniques such as X-ray crystallography or NMR spectroscopy. Bioinformatic analysis using algorithms like BLAST can identify homologous sequences across bacterial species, while predictive tools like SignalP, TopPred, and PSORT can help determine protein localization and potential membrane-spanning domains . Comparative sequence alignment with tsf proteins from other bacterial species would reveal conserved domains versus variable regions that may contribute to species-specific functions.

What are the optimal conditions for cloning and expressing recombinant Streptococcus pyogenes M5 tsf in E. coli?

For optimal cloning and expression of recombinant S. pyogenes M5 tsf in E. coli, researchers should consider a systematic approach similar to that used for other streptococcal proteins. Begin by constructing a gene bank of S. pyogenes strain M5 using a bacteriophage lambda vector-E. coli K-12 host system . PCR amplification of the tsf gene should include appropriate restriction sites for subcloning into expression vectors. For expression, consider using vectors with inducible promoters (like T7 or tac) to control protein production. Based on strategies used for other streptococcal proteins, expression conditions should be optimized by testing different:

  • E. coli host strains (BL21(DE3), Rosetta, etc.)

  • Induction temperatures (16-37°C)

  • IPTG concentrations (0.1-1.0 mM)

  • Duration of induction (3-18 hours)

The recombinant protein should be validated through immunoblotting using antisera raised against the purified protein, as demonstrated with the M5 protein . If expression levels are low or protein is insoluble, consider fusion tags (His-tag, GST, MBP) to improve solubility and facilitate purification.

What purification strategies are most effective for isolating recombinant S. pyogenes M5 tsf protein while maintaining its functional integrity?

Effective purification of recombinant S. pyogenes M5 tsf requires a multi-step approach to ensure functional integrity. Based on established protocols for streptococcal proteins, an optimal purification strategy would include:

  • Initial capture using affinity chromatography: If the recombinant tsf contains a His-tag, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin. Elution should employ an imidazole gradient (50-500 mM) to minimize co-purification of contaminants.

  • Intermediate purification: Ion exchange chromatography based on the theoretical pI of tsf (typically calculated from amino acid sequence) using either anion or cation exchange resins.

  • Polishing step: Size exclusion chromatography to remove aggregates and ensure a homogeneous preparation.

For maintaining functional integrity, all purification steps should be performed at 4°C with protease inhibitors. Buffer composition is critical - typically 20 mM Tris-HCl (pH 7.6) containing 150 mM NaCl is suitable, potentially supplemented with stabilizing agents like glycerol (10-20%) or reducing agents like DTT (1-5 mM) if the protein contains cysteine residues. Functionality should be assessed through GDP/GTP exchange assays, as tsf facilitates nucleotide exchange on EF-Tu during protein synthesis.

How can researchers effectively design antibodies against S. pyogenes M5 tsf to study its expression and localization?

Designing effective antibodies against S. pyogenes M5 tsf requires strategic epitope selection and validation approaches. A comprehensive strategy includes:

  • Epitope prediction and selection:

    • Analyze the tsf sequence using epitope prediction algorithms to identify regions with high antigenicity

    • Select multiple epitopes from different protein regions (preferably surface-exposed)

    • Avoid regions with high homology to human proteins or other bacterial species to reduce cross-reactivity

  • Antibody production options:

    • For polyclonal antibodies: Immunize rabbits with purified recombinant tsf protein (200-400 μg per immunization) using a prime-boost strategy with adjuvants

    • For monoclonal antibodies: Immunize mice with either full-length protein or KLH-conjugated peptides corresponding to predicted epitopes

    • Consider developing both approaches for complementary applications

  • Validation of antibody specificity:

    • Western blotting against recombinant tsf and whole cell lysates of S. pyogenes M5

    • Immunoprecipitation followed by mass spectrometry identification

    • Immunofluorescence microscopy with appropriate controls including isotype controls and pre-immune sera

    • Testing against tsf-knockout strains (if available) to confirm specificity

  • Application-specific considerations:

    • For localization studies, ensure antibodies recognize native conformations using non-denaturing techniques

    • For quantitative applications, validate antibody linearity across a concentration range

Similar to approaches used for M protein characterization, researchers might consider using synthetic peptides corresponding to specific regions of tsf to raise antisera with targeted specificity .

What are the optimal growth and harvesting conditions for maximizing tsf yield in recombinant expression systems?

To maximize tsf yield in recombinant expression systems, researchers should implement a comprehensive optimization strategy addressing multiple factors:

  • Growth media optimization:

    • Compare rich media (LB, TB, 2xYT) versus defined media

    • Consider supplementation with glucose (0.2-0.5%) to support higher cell densities

    • Test auto-induction media for leaky expression systems

  • Growth parameters:

    • Optimize growth temperature (pre-induction: typically 37°C; post-induction: 16-30°C)

    • Monitor growth phases and induce at optimal OD600 (typically 0.4-0.8 for exponential phase induction)

    • Control aeration and agitation (200-250 rpm for flask cultures)

  • Induction strategy:

    • Titrate inducer concentration (0.01-1.0 mM IPTG for lac-based systems)

    • Test extended expression times at lower temperatures (16-18°C for 18-24 hours)

    • Consider co-expression with chaperones if folding issues are observed

  • Harvesting conditions:

    • Harvest cells by centrifugation at 12,000 × g for 15 min at 4°C

    • Wash cell pellets with appropriate buffer (e.g., 20 mM Tris-HCl, pH 7.6 with 150 mM NaCl)

    • Consider flash freezing pellets in liquid nitrogen for storage at -80°C

  • Cell lysis optimization:

    • Compare mechanical (sonication, French press) versus chemical (lysozyme, detergents) lysis methods

    • Include protease inhibitors to prevent degradation

    • Optimize lysis buffer components to enhance protein solubility

Experimental data from S. pyogenes studies suggest monitoring both early-exponential (OD600 of 0.35) and late-exponential (OD600 of 0.75) growth phases, as protein expression can vary significantly between these stages .

How can researchers assess the functional activity of recombinant S. pyogenes M5 tsf protein in vitro?

Assessing the functional activity of recombinant S. pyogenes M5 tsf requires multiple complementary approaches focusing on its role in protein synthesis:

  • GDP/GTP Exchange Assay:

    • Measure the rate of nucleotide exchange on EF-Tu catalyzed by tsf

    • Experimental setup: Incubate purified EF-Tu·GDP with excess GTP and varying concentrations of tsf

    • Quantification: Monitor either GDP release using radiolabeled GDP (³H-GDP) or by FRET-based methods using fluorescently labeled nucleotides

  • Ternary Complex Formation:

    • Assess tsf's ability to promote formation of EF-Tu·GTP·aa-tRNA complex

    • Method: Size-exclusion chromatography or native PAGE to detect complex formation

    • Controls should include reactions without tsf to establish baseline complex formation

  • Translation elongation rate assay:

    • Use reconstituted in vitro translation systems supplemented with purified components

    • Compare polymerization rates with and without added recombinant tsf

    • Quantify using incorporation of radiolabeled amino acids or fluorescence-based detection

  • Thermal stability and conformational analysis:

    • Assess protein stability using differential scanning fluorimetry (DSF)

    • Compare stability profiles of recombinant tsf with native protein (if available)

    • Evaluate conformational integrity through circular dichroism spectroscopy

  • Binding kinetics characterization:

    • Determine binding constants for tsf-EF-Tu interaction using surface plasmon resonance (SPR)

    • Calculate association/dissociation rates (kon/koff) and equilibrium constants (KD)

For all functional assays, temperature optimization is critical as S. pyogenes is a human pathogen with optimal growth at 37°C .

What role does tsf play in the transcriptional regulatory network of S. pyogenes during infection?

While elongation factor Ts primarily functions in translation, it may have secondary roles in the transcriptional regulatory network (TRN) of S. pyogenes. To investigate these potential connections:

  • Transcriptomic analysis:

    • Conduct RNA sequencing under tsf overexpression or knockdown conditions

    • Apply independent component analysis (ICA) similar to methods used for identifying independently modulated gene sets (iModulons) in S. pyogenes

    • Compare expression profiles between wild-type and tsf-modified strains across different growth phases and environmental conditions

  • Proteome-wide interaction studies:

    • Perform co-immunoprecipitation with tagged tsf followed by mass spectrometry

    • Use bacterial two-hybrid systems to screen for potential regulatory protein interactions

    • Apply crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Regulatory network modeling:

    • Integrate tsf expression data into existing TRN models

    • Identify potential correlations between tsf expression levels and known regulatory modules

    • Similar to analysis of the nga-ifs-slo operon , investigate whether tsf responds to specific carbon sources or environmental signals

  • In vivo infection models:

    • Compare virulence and gene expression patterns between wild-type and tsf-modified strains

    • Evaluate temporal changes in tsf expression during different infection stages

    • Assess how host immune responses might affect tsf expression and function

Current research on S. pyogenes TRN has identified 42 independently modulated sets of genes , which provides a framework for positioning tsf within this complex regulatory landscape. Comparative analysis of tsf expression across these regulatory modules could reveal unexpected functional connections beyond its canonical role in translation.

How does recombinant tsf interact with other elongation factors and the ribosome in translation assays?

Understanding the interactions between recombinant S. pyogenes M5 tsf, other elongation factors, and the ribosome requires sophisticated biochemical and structural approaches:

  • Reconstituted translation system assays:

    • Establish a minimal translation system using purified components (ribosomes, mRNA, tRNAs, translation factors)

    • Compare translation efficiency with S. pyogenes tsf versus tsf from other species

    • Quantify effects on translation rate, accuracy, and processivity

  • Ribosome binding studies:

    • Analyze direct binding of labeled tsf to ribosomes using filter binding assays or fluorescence anisotropy

    • Perform competition assays with other elongation factors to determine binding hierarchies

    • Map binding sites using chemical footprinting or cryo-EM

  • Real-time kinetic analysis:

    • Monitor translation dynamics using FRET-based reporters between tsf and EF-Tu

    • Measure residence times of tsf on the ribosome during active translation

    • Quantify the kinetics of EF-Tu·GDP regeneration to EF-Tu·GTP facilitated by tsf

  • Structural studies:

    • Obtain cryo-EM structures of tsf in complex with the ribosome and/or EF-Tu

    • Compare with existing structures from model organisms to identify S. pyogenes-specific features

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Effect of antibiotics:

    • Test how translation-targeting antibiotics affect tsf interactions

    • Determine if S. pyogenes tsf confers any specific antibiotic resistance properties

The data from these experiments should be compiled into interaction models similar to those developed for well-characterized translation systems, with particular attention to any unique features of the S. pyogenes translation machinery that might be exploited for therapeutic development.

How can CRISPR-Cas9 genome editing be utilized to study tsf function in S. pyogenes M5?

CRISPR-Cas9 genome editing offers powerful approaches for investigating tsf function in S. pyogenes M5 through precise genetic manipulation:

  • Knockout strategy for essentiality testing:

    • Design sgRNAs targeting multiple sites within the tsf gene

    • Construct conditional knockout systems if tsf is essential (inducible promoters or CRISPRi)

    • Develop complementation strategies using plasmid-expressed wild-type tsf

    • Analyze growth curves, morphology, and stress responses in tsf-depleted conditions

  • Domain-specific mutations:

    • Introduce point mutations in functional domains to create separation-of-function variants

    • Target conserved residues identified through sequence alignment with characterized tsf proteins

    • Create tagged versions (His, FLAG) for immunoprecipitation studies while preserving function

    • Validate mutants by sequencing and expression analysis

  • Promoter manipulation:

    • Replace native promoter with inducible/repressible systems to control expression levels

    • Create reporter fusions (GFP, luciferase) to monitor tsf expression under different conditions

    • Analyze how altered expression affects global translation rates and virulence

  • Experimental considerations:

    • Delivery method: Electroporation of ribonucleoprotein complexes or plasmid-based systems

    • Selection: Design strategies for identifying successful edits (antibiotic markers, fluorescent reporters)

    • Off-target analysis: Whole genome sequencing to confirm specificity of edits

    • Phenotypic characterization: Compare mutants using transcriptomics, proteomics, and virulence assays

This approach parallels methods used for functional dissection of the M5 protein , where targeted mutations allowed researchers to determine the contribution of different protein regions to virulence and host interactions.

What are the implications of tsf structural variations across different S. pyogenes serotypes for vaccine development?

Understanding tsf structural variations across S. pyogenes serotypes has significant implications for vaccine development:

  • Conservation analysis:

    • Perform comprehensive sequence alignment of tsf across all known S. pyogenes serotypes

    • Identify conserved epitopes versus variable regions

    • Quantify selection pressure on different protein domains using dN/dS analysis

    • Compare with known variations in M proteins, which show high N-terminal variability among >150 serotypes

  • Epitope mapping and antigenicity assessment:

    • Use peptide arrays to identify immunodominant regions

    • Determine cross-reactivity of antibodies raised against M5 tsf with tsf from other serotypes

    • Evaluate conservation of potential B-cell and T-cell epitopes

    • Assess epitope accessibility through structural modeling

  • Host cross-reactivity screening:

    • Test for potential autoimmune reactions similar to those observed with M protein (cross-reactivity with human cardiac myosin)

    • Perform extensive homology searches against human proteins

    • Conduct in vitro and in vivo safety assessments similar to those used for other recombinant S. pyogenes vaccines

  • Vaccine formulation considerations:

    • Evaluate potential for a multi-serotype approach versus conserved epitope strategy

    • Consider carrier protein conjugation methods similar to those used for Group A Carbohydrate vaccines

    • Test aluminum hydroxide and other adjuvants for optimal immune response

    • Assess stability and immunogenicity of different tsf formulations

ApproachAdvantagesLimitationsKey Considerations
Full-length tsfComplete epitope spectrumPotential cross-reactivityPurification complexity
Conserved epitope peptidesBroad serotype coverageLimited epitope diversityCarrier protein selection
Multi-serotype cocktailComprehensive coverageManufacturing complexityEpitope interference
tsf-fusion constructsEnhanced immunogenicityComplex validationFusion partner selection

Compared to M protein-based vaccines, which face limitations due to high serotype variability (>150 serotypes) , a tsf-based approach might offer broader protection if sufficiently conserved regions can be identified and properly formulated.

How can high-throughput screening be implemented to identify small molecule inhibitors of S. pyogenes tsf function?

Implementing high-throughput screening (HTS) for S. pyogenes tsf inhibitors requires a systematic approach encompassing assay development, compound screening, and hit validation:

  • Primary assay development:

    • Design a fluorescence-based nucleotide exchange assay measuring tsf-catalyzed GDP/GTP exchange on EF-Tu

    • Optimize for 384 or 1536-well format with Z' factor >0.5 for statistical robustness

    • Establish positive controls using known translation inhibitors or tsf mutants

    • Miniaturize reaction components to reduce cost (typical volume 20-50 μL)

  • Compound library selection:

    • Diversity-oriented libraries (10,000-100,000 compounds)

    • Known bioactives collection (FDA-approved drugs for repurposing)

    • Natural product extracts (particularly from sources with antimicrobial properties)

    • Fragment libraries for structure-based optimization

  • Primary screen and hit selection:

    • Screen at single concentration (10-20 μM) initially

    • Set threshold criteria (typically >50% inhibition)

    • Implement statistical analysis to identify significant hits

    • Filter for pan-assay interference compounds (PAINS)

  • Secondary assays for hit validation:

    • Dose-response curves to determine IC50 values

    • Counter-screens against human EF-Ts to assess selectivity

    • Thermal shift assays to confirm direct binding

    • In vitro translation assays to verify mechanism

  • Tertiary characterization:

    • Bacteriostatic/bactericidal determination

    • Minimum inhibitory concentration (MIC) against S. pyogenes strains

    • Resistance development frequency

    • Cytotoxicity against human cell lines

  • Mechanistic studies:

    • Site-directed mutagenesis to identify binding sites

    • X-ray crystallography or cryo-EM of tsf-inhibitor complexes

    • Computational modeling for structure-activity relationship development

Assay TypeReadoutThroughputAdvantagesLimitations
GDP/GTP ExchangeFluorescenceHighDirect functional measurePotential interference
Thermal ShiftFluorescenceMedium-HighConfirms bindingIndirect functional measure
FRET-based bindingFRETMediumReal-time kineticsComplex setup
Cell-based growthOD600MediumWhole-cell activityTarget specificity unclear
In vitro translationLuminescenceLowPhysiological relevanceComplex, expensive

The most promising hits would advance to medicinal chemistry optimization and in vivo efficacy testing in animal infection models.

How might post-translational modifications of tsf affect its function in S. pyogenes virulence?

Post-translational modifications (PTMs) of tsf could significantly impact its function in S. pyogenes virulence through multiple mechanisms:

  • Identification of potential PTMs:

    • Mass spectrometry-based proteomics to identify phosphorylation, methylation, acetylation, etc.

    • Compare PTM profiles between in vitro culture and in vivo infection conditions

    • Use site-specific antibodies to track modification states during infection progression

  • Functional impact assessment:

    • Generate site-directed mutants that either mimic PTMs (e.g., Ser→Asp for phosphorylation) or prevent modifications (e.g., Ser→Ala)

    • Measure effects on:

      • Translation efficiency and fidelity

      • Protein-protein interactions

      • Subcellular localization

      • Stability and turnover rates

  • Regulation of PTMs:

    • Identify kinases, acetylases, or other enzymes responsible for tsf modifications

    • Determine environmental triggers that alter modification patterns

    • Integrate with known virulence regulatory networks, similar to the analysis of independently modulated gene sets (iModulons) in S. pyogenes

  • Impact on virulence:

    • Compare virulence of strains expressing wild-type tsf versus PTM-mimetic or PTM-deficient mutants

    • Assess effects on expression of known virulence factors

    • Evaluate host immune recognition of differently modified tsf variants

  • Therapeutic implications:

    • Determine if PTM-dependent functions represent specific therapeutic targets

    • Assess whether PTMs affect antibody recognition in potential vaccine applications

    • Explore whether blocking specific modifications could attenuate virulence

While no specific information about tsf PTMs in S. pyogenes is provided in the search results, proteomic approaches similar to those used to identify surface-associated proteins could be adapted to characterize the PTM landscape of tsf under different conditions.

What is the role of tsf in S. pyogenes biofilm formation and antibiotic resistance?

The potential role of tsf in S. pyogenes biofilm formation and antibiotic resistance represents an understudied area with significant clinical implications:

  • Biofilm formation studies:

    • Compare biofilm formation between wild-type and tsf-modulated strains (overexpression/knockdown)

    • Quantify biofilm parameters (thickness, density, matrix composition) using confocal microscopy and biomass assays

    • Assess tsf expression levels within different biofilm regions using reporter constructs

    • Determine if tsf is selectively expressed during biofilm formation versus planktonic growth

  • Stress response connection:

    • Evaluate how translation modulation via tsf affects persistence under antibiotic stress

    • Test whether tsf expression changes during exposure to sub-inhibitory antibiotic concentrations

    • Assess recovery rates following antibiotic treatment in tsf-modulated strains

    • Determine if tsf contributes to the stringent response during nutrient limitation in biofilms

  • Mechanistic investigations:

    • Screen for tsf interactions with known biofilm regulators using co-immunoprecipitation

    • Perform transcriptome analysis of biofilms formed by wild-type versus tsf-modified strains

    • Determine if tsf affects translation of specific mRNAs encoding biofilm-related proteins

    • Assess whether tsf influences the production of extracellular polymeric substances

  • Clinical relevance:

    • Analyze tsf expression in clinical isolates with varying biofilm-forming capabilities

    • Compare antibiotic susceptibility profiles between planktonic and biofilm cultures

    • Test combination therapies targeting both tsf function and biofilm integrity

    • Evaluate the efficacy of anti-tsf antibodies in disrupting established biofilms

Similar to the approach used to study the transcriptional regulatory network in S. pyogenes , researchers could analyze how tsf expression correlates with biofilm-associated transcriptional modules under different environmental conditions.

How can structural information about S. pyogenes tsf inform the design of novel antimicrobial agents?

Leveraging structural information about S. pyogenes tsf to design novel antimicrobials requires a multi-disciplinary approach combining structural biology, medicinal chemistry, and computational methods:

  • Structure determination priorities:

    • Obtain high-resolution structures of S. pyogenes tsf alone and in complex with EF-Tu

    • Identify unique structural features compared to human elongation factors

    • Map the nucleotide exchange catalytic site and protein-protein interaction interfaces

    • Determine conformational changes during the functional cycle

  • Structure-based drug design strategy:

    • Virtual screening of compound libraries against identified binding pockets

    • Fragment-based approaches to identify chemical scaffolds with high ligand efficiency

    • Structure-activity relationship studies to optimize binding affinity and selectivity

    • Molecular dynamics simulations to identify transient binding pockets not visible in static structures

  • Targeting approaches:

    • Competitive inhibitors that prevent tsf-EF-Tu interaction

    • Allosteric modulators that lock tsf in inactive conformations

    • Covalent inhibitors targeting unique cysteine residues in S. pyogenes tsf

    • Peptide mimetics based on the interacting interfaces

  • Design considerations:

    • Selectivity over human EF-Ts to minimize toxicity

    • Physicochemical properties compatible with bacterial cell penetration

    • Resistance barriers through targeting highly conserved and functionally essential residues

    • Potential for synergy with existing antibiotics

  • Validation methods:

    • X-ray crystallography or cryo-EM to confirm binding modes

    • Site-directed mutagenesis to validate key interaction residues

    • In vitro translation assays to confirm mechanism of action

    • Resistance development studies to assess genetic barriers

Target SiteAdvantagesChallengesDesign Strategy
EF-Tu binding interfaceDirect inhibition of functionPotential conservation with human systemFocus on species-specific residues
Nucleotide exchange siteCentral to functionMay have conserved architectureTarget unique conformational states
Allosteric sitesPotentially higher specificityMore difficult to identifyComputational pocket detection
Dimerization interfaceMay affect functional complexesFunctional relevance needs validationProtein-protein interaction disruptors

Similar to the approach used for identifying surface-associated proteins in S. pyogenes for vaccine development , structural characterization of tsf could reveal unique features that might be exploited for selective therapeutic targeting.

What are the major challenges in expressing soluble, functional recombinant S. pyogenes tsf in heterologous systems?

Expressing soluble, functional recombinant S. pyogenes tsf in heterologous systems presents several challenges that require systematic troubleshooting:

  • Codon usage optimization:

    • Challenge: S. pyogenes has different codon preferences than common expression hosts

    • Solution: Optimize the tsf gene sequence for the expression host while maintaining critical structural elements

    • Implementation: Use algorithms that balance host codon bias while preserving mRNA secondary structures important for proper folding

  • Protein solubility and folding:

    • Challenge: Heterologous expression often leads to inclusion body formation

    • Solutions:

      • Fusion tags: Test multiple solubility-enhancing tags (MBP, SUMO, TrxA)

      • Expression conditions: Lower temperatures (16-20°C) and reduced inducer concentrations

      • Co-expression with chaperones (GroEL/ES, DnaK/J) to assist folding

      • Consider cell-free expression systems for difficult proteins

  • Protein degradation:

    • Challenge: Proteolytic degradation in the expression host

    • Solutions:

      • Use protease-deficient host strains (BL21, Rosetta)

      • Include protease inhibitors during purification

      • Optimize buffer conditions (pH, salt concentration) to minimize degradation

      • Identify and modify protease-susceptible sites through mutagenesis

  • Functional validation:

    • Challenge: Ensuring the recombinant protein retains native activity

    • Solutions:

      • Develop activity assays specific for tsf function (nucleotide exchange assays)

      • Compare structural parameters (circular dichroism, thermal stability) with native protein

      • Validate through complementation of conditional tsf mutants

  • Purification strategy optimization:

    • Challenge: Obtaining pure, homogeneous protein preparations

    • Solutions:

      • Multi-step purification combining affinity, ion exchange, and size exclusion chromatography

      • On-column refolding for proteins recovered from inclusion bodies

      • Stability screening to identify optimal buffer conditions for long-term storage

Common IssueDiagnostic IndicationPotential SolutionsSuccess Metrics
Insoluble expressionProtein in pellet after lysisLower temperature, solubility tags>50% in soluble fraction
Low expressionWeak band on SDS-PAGECodon optimization, different promoterVisible band on Coomassie stain
DegradationMultiple smaller bandsProtease inhibitors, shorter inductionSingle band on Western blot
MisfoldingActivity loss, aggregationChaperone co-expressionPositive activity assay
Purification lossesDecreasing yield with each stepOptimize binding/elution conditions>70% recovery per step

Similar challenges were likely encountered during the expression of recombinant S. pyogenes M proteins, which required careful optimization of conditions to maintain their functional integrity .

How can researchers overcome difficulties in generating specific antibodies against highly conserved translation factors like tsf?

Generating specific antibodies against highly conserved proteins like tsf presents unique challenges that require specialized approaches:

  • Epitope selection strategy:

    • Challenge: High conservation between bacterial tsf proteins and potential similarity with host homologs

    • Solutions:

      • Bioinformatic analysis to identify S. pyogenes-specific regions within tsf

      • Focus on surface-exposed loops that may contain species-specific sequences

      • Use multiple short peptides rather than full-length protein for immunization

      • Consider computational epitope prediction algorithms to identify unique, immunogenic regions

  • Immunization approaches:

    • Challenge: Breaking self-tolerance for conserved epitopes

    • Solutions:

      • Use diverse animal species whose endogenous tsf differs maximally from S. pyogenes

      • Employ strong adjuvant formulations (e.g., complete Freund's with subsequent boosters)

      • Consider DNA immunization to enhance immune response

      • Use carrier proteins to increase immunogenicity of conserved peptides

  • Antibody screening and selection:

    • Challenge: Distinguishing specific from cross-reactive antibodies

    • Solutions:

      • Implement counter-screening against tsf proteins from related species

      • Develop competition ELISAs to identify antibodies with preferred specificity

      • Use epitope mapping to confirm binding to targeted regions

      • Validate with knockout controls where available

  • Affinity maturation and engineering:

    • Challenge: Obtaining high-affinity antibodies to weakly immunogenic epitopes

    • Solutions:

      • In vitro affinity maturation through display technologies (phage, yeast)

      • Site-directed mutagenesis of complementarity-determining regions (CDRs)

      • Humanization/camelization for research applications requiring specific characteristics

  • Validation for specific applications:

    • Challenge: Ensuring antibodies work in intended applications

    • Solutions:

      • Validate across multiple techniques (Western, ELISA, IP, IHC)

      • Test under native and denaturing conditions

      • Confirm specificity in complex biological samples

Similar challenges were likely encountered during the development of antibodies against S. pyogenes surface proteins, where researchers needed to distinguish between serotype-specific and conserved epitopes .

What are the best practices for ensuring reproducibility in functional studies of recombinant S. pyogenes tsf?

Ensuring reproducibility in functional studies of recombinant S. pyogenes tsf requires rigorous experimental design and standardization:

  • Protein preparation standardization:

    • Challenge: Batch-to-batch variation in protein quality

    • Best practices:

      • Develop comprehensive standard operating procedures (SOPs) for expression and purification

      • Implement quality control criteria (purity by SDS-PAGE, activity thresholds, endotoxin levels)

      • Aliquot and store proteins under validated conditions to prevent freeze-thaw degradation

      • Include functional controls with each new preparation

  • Activity assay standardization:

    • Challenge: Variability in assay conditions affecting results

    • Best practices:

      • Establish detailed protocols with defined reagent sources and lot numbers

      • Include internal standards and controls in every experiment

      • Define acceptance criteria for assay validation (Z-factor, signal-to-noise ratio)

      • Document environmental conditions (temperature, humidity) that may affect results

  • Data collection and analysis:

    • Challenge: Inconsistent analysis methods leading to different interpretations

    • Best practices:

      • Pre-specify analysis methods, including statistical approaches

      • Use automated data collection systems where possible to reduce operator bias

      • Implement blinding procedures for subjective measurements

      • Maintain detailed electronic lab notebooks with raw data preservation

  • Biological validation:

    • Challenge: Confirming biological relevance of in vitro findings

    • Best practices:

      • Correlate biochemical activity with cellular phenotypes

      • Test activity across physiologically relevant conditions (pH, temperature, ion concentrations)

      • Validate key findings with complementary experimental approaches

      • Compare results with predictions from established models of translation

  • Reporting and transparency:

    • Challenge: Incomplete methods reporting hampering reproduction

    • Best practices:

      • Follow reporting guidelines such as ARRIVE for animal studies

      • Provide detailed methods including all buffer compositions

      • Deposit protocols in repositories like Protocols.io

      • Share unique reagents through appropriate repositories

ElementCommon IssueBest PracticeValidation Approach
Protein purityContaminants affecting results>95% by SDS-PAGE; Mass spec verificationActivity correlation with purity
Activity assaysDay-to-day variationStandard curves with each experimentCoefficient of variation <15%
EquipmentCalibration differencesRegular calibration verificationKnown standards testing
ReagentsLot-to-lot variationSingle lot for critical studiesParallel testing of new lots
Data analysisSubjective interpretationPre-specified analysis pipelinesBlind analysis by multiple researchers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.