Recombinant Streptococcus sanguinis Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Streptococcus sanguinis CobD

Cobalamin biosynthesis protein CobD is encoded by the cobD gene (designated as SSA_0464 in the S. sanguinis genome) and plays a crucial role in vitamin B12 synthesis. This protein is part of a 70-kb genomic region in S. sanguinis that encodes pathways for vitamin B12 biosynthesis and degradation of ethanolamine and propanediol . This region was apparently acquired by horizontal gene transfer, providing S. sanguinis with unique metabolic capabilities compared to other streptococci. The presence of the complete vitamin B12 biosynthesis pathway in S. sanguinis is particularly significant as it appears to be the first complete pathway identified in streptococci .

Genetic Characteristics

The cobD gene in S. sanguinis has been fully characterized with the following features:

Gene InformationDetails
Gene NamecobD
Locus TagSSA_0464
SynonymsCobalamin biosynthesis protein CobD
UniProt IDA3CL57
Genomic Position468365..469315
Gene Length951 nucleotides

Source: KEGG database

Enzymatic Activity

CobD functions as an adenosylcobinamide-phosphate synthase (EC 6.3.1.10) in the cobalamin biosynthetic pathway . This enzyme catalyzes the conversion of adenosylcobinamide to adenosylcobinamide-phosphate, a critical step in the assembly of the nucleotide loop of vitamin B12. The reaction involves:

Adenosylcobinamide + ATP → Adenosylcobinamide phosphate + ADP

This reaction falls under the enzyme class of ligases, specifically those forming carbon-nitrogen bonds (acid-D-ammonia or amine ligases) .

Role in the Vitamin B12 Biosynthetic Pathway

Vitamin B12 biosynthesis is an intricate process involving approximately 30 enzymatic steps. The pathway can proceed through either aerobic or anaerobic routes, differing primarily in when cobalt is inserted into the corrin ring structure. Genomic analysis indicates that S. sanguinis possesses all genes required for the anaerobic cobalamin biosynthesis pathway .

The complete vitamin B12 biosynthesis pathway in S. sanguinis involves several stages:

  1. Synthesis of the corrinoid ring structure

  2. Cobalt insertion (early in the anaerobic pathway)

  3. Ring contraction and methylation steps

  4. Assembly of the nucleotide loop (where CobD functions)

  5. Attachment of the lower ligand (typically 5,6-dimethylbenzimidazole)

CobD specifically participates in the assembly of the nucleotide loop, which is essential for the final structure and function of vitamin B12 .

Metabolic Context and Significance

The presence of a complete vitamin B12 biosynthetic pathway in S. sanguinis is metabolically significant for several reasons:

  1. Metabolic Versatility: Vitamin B12 serves as a cofactor for various enzymes involved in diverse processes, including DNA synthesis, and in both fatty acid and amino acid metabolism .

  2. Ecological Advantage: Many bacteria require vitamin B12 but cannot synthesize it themselves. The ability to produce this vitamin may give S. sanguinis an advantage in the competitive environment of the oral microbiome .

  3. Utilization of Alternative Carbon Sources: The co-localization of vitamin B12 biosynthesis genes with ethanolamine and propanediol utilization pathways suggests that S. sanguinis may utilize these compounds as carbon and energy sources .

Expression Systems and Production

Recombinant S. sanguinis CobD protein is typically produced by expressing the cobD gene in Escherichia coli expression systems. The recombinant protein is generally produced as a full-length protein (covering amino acids 1-316) with an N-terminal His tag to facilitate purification .

The typical production process involves:

  1. Cloning the cobD gene into an expression vector

  2. Transformation into E. coli expression hosts

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography (utilizing the His tag)

  6. Additional purification steps as needed

Role in S. sanguinis Biology

The ability to synthesize vitamin B12 may contribute to several aspects of S. sanguinis biology:

  1. Colonization Ability: The metabolic versatility conferred by vitamin B12 biosynthesis may enhance the ability of S. sanguinis to colonize the oral cavity as a primary colonizer .

  2. Bacterial Competition: S. sanguinis is known to antagonize oral pathogens such as Streptococcus mutans, though the specific role of vitamin B12 metabolism in this interaction remains to be fully explored .

  3. Biofilm Formation: As an early colonizer, S. sanguinis plays a role in biofilm formation on tooth surfaces. The metabolic capabilities enabled by vitamin B12 may contribute to this process .

Potential Role in Pathogenesis

While S. sanguinis is generally considered beneficial in the oral microbiome, it can cause infective endocarditis under certain conditions. The potential role of vitamin B12 biosynthesis in pathogenesis includes:

  1. Metabolic Adaptation: The ability to synthesize vitamin B12 might help S. sanguinis adapt to nutrient-limited environments encountered during infection .

  2. Manganese and Iron Homeostasis: Studies have shown interactions between metal ion transport (particularly manganese and iron) and oxidative stress resistance in S. sanguinis, which may indirectly involve B12-dependent metabolism .

  3. Survival in Host Environments: Vitamin B12 synthesis may contribute to survival in blood and serum, which is important for endocarditis development .

Biotechnological Applications

Understanding the vitamin B12 biosynthetic pathway in S. sanguinis has several potential applications:

  1. Vitamin Production: Insights from studying bacterial vitamin B12 biosynthesis could inform efforts to improve industrial production of this vitamin, which is currently achieved primarily through microbial fermentation using Propionobacterium shermanii and Pseudomonas denitrificans .

  2. Enzyme Engineering: CobD and other enzymes in the pathway could be targets for protein engineering to enhance activity or modify specificity.

  3. Oral Probiotics: The beneficial role of S. sanguinis in the oral microbiome, potentially related to its metabolic capabilities including vitamin B12 synthesis, suggests its possible use in probiotic applications .

Knowledge Gaps

Despite the identification of CobD and the vitamin B12 biosynthetic pathway in S. sanguinis, several important questions remain unanswered:

  1. Regulation of Expression: How is the expression of cobD and other vitamin B12 biosynthesis genes regulated in response to environmental conditions and nutrient availability?

  2. Structural Details: What are the detailed three-dimensional structural features of CobD, and how do they relate to its enzymatic function?

  3. Ecological Role: What role does vitamin B12 production play in the interactions between S. sanguinis and other members of the oral microbiome?

  4. Role in Virulence: Does vitamin B12 biosynthesis contribute to virulence in infective endocarditis, and if so, through what mechanisms?

Future Research Directions

To address these gaps, several research approaches could be pursued:

  1. Structural Biology: Determination of the three-dimensional structure of CobD using X-ray crystallography or cryo-electron microscopy.

  2. Genetic Studies: Creation and characterization of cobD mutants to understand the role of this gene in vivo, particularly in biofilm formation and interspecies interactions.

  3. Metabolomic Analysis: Investigation of vitamin B12 production and utilization under various conditions, including those mimicking the oral environment and endocarditis.

  4. Transcriptomic Studies: Analysis of gene expression patterns to understand the regulation of cobD and related genes in response to different environmental stimuli.

  5. Ecological Studies: Examination of the interactions between S. sanguinis and other oral microorganisms, focusing on the potential role of vitamin B12 metabolism in these interactions.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
cobD; SSA_0464; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Streptococcus sanguinis (strain SK36)
Target Names
cobD
Target Protein Sequence
MTLIAIFLAVLLDWLIGDPYSWPHPVKWMGSYIYLCMRLQEKKQFSPYLFGFFLWLTTVG LALGVSCGLLWLAGLAHPVLYWLVWIYLAYASLAAKSLAFEAQKVYHTLKFGTLEEARKQ VGMIVGRETSQLTPEEISKATIETVAENTSDGVIGPLLCLFLGGPILAMTYKAINTLDSM VGYKTEKYRKIGLISAKMDDLANLIPARLTWLFLILSSQILLLDVKGALRIGWRDRYQHA SPNSAFSEAVVAGALGIQLGGPHVYHGELIEKPTIGEDSRPVEADDIQTAISLLYTSTMT GLILFTLFYLVMQAYF
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Streptococcus sanguinis CobD in cobalamin biosynthesis?

S. sanguinis CobD functions as an L-threonine-O-3-phosphate decarboxylase enzyme that is critical in the cobalamin (vitamin B12) biosynthetic pathway. It catalyzes the decarboxylation of L-threonine-O-3-phosphate to generate (R)-1-amino-2-propanol-O-2-phosphate, which serves as a precursor for the aminopropanol component of the nucleotide loop in cobalamin . This enzymatic activity is essential for the attachment of the aminopropanol moiety to the f side chain of cobyric acid, a key intermediate in the cobalamin biosynthesis pathway. Without functional CobD, organisms typically accumulate cobyric acid and cannot complete the synthesis of biologically active cobalamin .

CobD represents one of the many specialized enzymes involved in the complex multi-step biosynthesis of cobalamin, which differs between aerobic and anaerobic pathways. In the context of Streptococcus sanguinis, understanding CobD's role provides insights into how this oral pathogen maintains essential metabolic functions.

How does S. sanguinis CobD compare structurally to CobD from other bacterial species?

Based on structural studies of CobD from Salmonella enterica, which shares homology with S. sanguinis CobD, the protein exists as a dimer in which each subunit consists of a large and a small domain . The structure reveals similarities to members of the aspartate aminotransferase family, with particular resemblance to histidinol phosphate aminotransferase . This suggests an evolutionary relationship between these enzymes despite their different catalytic functions.

The active site architecture of CobD has been elucidated through structural determination of the apo state, the substrate complex, and the product-aldimine complex . These structural insights have helped explain how CobD directs the breakdown of the external aldimine toward decarboxylation rather than amino transfer, which is the typical reaction for related enzymes .

While specific structural details of S. sanguinis CobD have not been explicitly detailed in the available literature, the high degree of conservation in cobalamin biosynthesis enzymes suggests similar structural features to those observed in S. enterica CobD.

What expression systems are most effective for producing recombinant S. sanguinis CobD?

For recombinant expression of S. sanguinis CobD, E. coli-based expression systems are typically most effective due to their high yield, ease of genetic manipulation, and established protocols. The most common approach involves:

  • Gene optimization: Codon optimization for E. coli expression to enhance translation efficiency

  • Vector selection: pET series vectors with T7 promoters for high-level expression

  • Fusion tags: His-tag fusion for simplified purification via metal affinity chromatography

  • Host strains: BL21(DE3) or Rosetta strains to address codon bias issues

Expression typically involves induction with IPTG at reduced temperatures (16-25°C) to enhance proper folding. Purification protocols generally employ immobilized metal affinity chromatography followed by size exclusion chromatography to achieve high purity.

For functional studies, it's crucial to verify that the recombinant protein maintains enzymatic activity through appropriate decarboxylase assays using L-threonine-O-3-phosphate as substrate.

What analytical methods are most effective for characterizing S. sanguinis CobD enzymatic activity?

To effectively characterize the enzymatic activity of S. sanguinis CobD, researchers should consider a multi-method approach:

Spectrophotometric Assays:

  • Monitoring the release of CO₂ through coupled enzyme assays

  • Following the consumption of L-threonine-O-3-phosphate or formation of (R)-1-amino-2-propanol-O-2-phosphate using spectrophotometric methods

Chromatographic Methods:

  • HPLC analysis to separate and quantify substrate and product

  • LC-MS/MS for precise identification and quantification of reaction products

Isotopic Labeling:

  • Use of ¹⁴C-labeled substrates to track decarboxylation

  • NMR spectroscopy with ¹³C-labeled substrates to follow reaction progression

Kinetic Parameters Determination:

  • Michaelis-Menten kinetics determination (Km, kcat, Vmax)

  • Inhibitor studies to probe active site architecture

Based on studies with related CobD enzymes, the optimal assay conditions typically include:

ParameterOptimal RangeNotes
pH7.5-8.0Phosphate or HEPES buffer
Temperature30-37°CS. sanguinis is mesophilic
CofactorsPyridoxal 5'-phosphate (PLP)Essential prosthetic group
Substrate concentration0.1-5 mMFor Michaelis-Menten conditions
Divalent cations1-5 mM Mg²⁺May enhance activity

When evaluating activity, it's important to consider that CobD forms an external aldimine complex during catalysis, which has been structurally characterized in related enzymes .

How does the cobalamin biosynthetic pathway in S. sanguinis differ from other bacterial species?

The cobalamin biosynthetic pathway in bacteria follows either aerobic or anaerobic routes, with significant differences in enzyme requirements and intermediate formation. While specific details of S. sanguinis cobalamin biosynthesis are not fully characterized in the available search results, comparison with well-studied systems provides valuable context.

Based on comparative genomics and characterized systems like those in Salmonella enterica and Pseudomonas denitrificans, key differences typically include:

  • Timing of cobalt insertion: In aerobic pathways (like P. denitrificans), cobalt is inserted late, while in anaerobic pathways (like S. enterica), it occurs early .

  • Ring contraction mechanism: Aerobic pathways require molecular oxygen for ring shrinkage, while anaerobic pathways use oxygen-independent mechanisms .

  • Enzyme complement: The anaerobic pathway utilizes different enzymes (Cbi series) compared to the aerobic pathway (Cob series) .

This comparative analysis is summarized in the following table adapted from the literature on cobalamin biosynthesis pathways:

Pathway FeatureAerobic Pathway (e.g., P. denitrificans)Anaerobic Pathway (e.g., S. enterica)Implications for S. sanguinis
Cobalt insertionLate stageEarly stageLikely follows anaerobic pattern
Ring contractionOxygen-dependentOxygen-independentAdaptable to various oxygen levels
Key methyltransferasesCobA, CobI, CobJ, CobM, etc.CysG, CbiL, CbiH, CbiF, etc.Contains homologs to anaerobic enzymes
Intermediate handlingForms precorrin intermediatesForms cobalt-precorrin intermediatesPathway likely resembles anaerobic route

Understanding these differences is crucial for experimental design when studying S. sanguinis CobD function in the context of the complete biosynthetic pathway .

What is the relationship between CobD function and S. sanguinis virulence?

The relationship between CobD function and S. sanguinis virulence presents an intriguing research question. S. sanguinis is known to cause infective endocarditis, and its cell wall-anchored proteins play important roles in virulence . While direct evidence linking CobD to virulence is limited in the available search results, several indirect connections can be hypothesized:

  • Metabolic fitness: Cobalamin is essential for several metabolic processes. Functional CobD ensures complete cobalamin biosynthesis, potentially supporting S. sanguinis growth and survival during infection.

  • Biofilm formation: S. sanguinis is a primary colonizer in dental plaque biofilms. Metabolic sufficiency through functional cobalamin biosynthesis may support biofilm establishment.

  • Competitive advantage: In the oral microbiome, the ability to synthesize cobalamin could provide a competitive advantage over species requiring exogenous vitamin B12.

  • Stress response: Cobalamin-dependent enzymes may be important during host-imposed stress conditions encountered during the infection process.

A comprehensive evaluation of S. sanguinis virulence factors identified 33 predicted cell wall-anchored proteins—a number much larger than those found in related species . While targeted signature-tagged mutagenesis (STM) approaches have been used to evaluate individual contributions to virulence, no single cell wall-anchored protein was found to be essential for the development of early infective endocarditis . This suggests that virulence likely depends on multiple factors working in concert rather than individual proteins.

Future research exploring specific cobD gene knockouts and their effects on S. sanguinis virulence in animal models would provide valuable insights into this relationship.

What structural biology approaches best elucidate the catalytic mechanism of S. sanguinis CobD?

To thoroughly elucidate the catalytic mechanism of S. sanguinis CobD, an integrated structural biology approach is recommended:

X-ray Crystallography:
The primary method for determining CobD structure, as previously successful with Salmonella enterica CobD . Critical structures to obtain include:

  • Apo enzyme structure

  • Enzyme-substrate complex (with L-threonine-O-3-phosphate)

  • External aldimine complex

  • Product-bound state

These structures provide snapshots of the catalytic cycle and can reveal conformational changes associated with substrate binding and product formation.

Cryo-Electron Microscopy:
For capturing different conformational states of CobD, particularly if crystallization proves challenging. This approach can reveal dynamic aspects of the enzyme's function.

NMR Spectroscopy:
To study protein dynamics and substrate interactions in solution, providing complementary information to crystal structures.

Computational Methods:

  • Molecular dynamics simulations to understand conformational changes

  • Quantum mechanics/molecular mechanics (QM/MM) calculations to model the reaction mechanism

  • Homology modeling based on related structures if experimental structures are unavailable

Site-Directed Mutagenesis:
Based on structural data, key residues in the active site should be mutated to confirm their roles in:

  • Substrate binding

  • PLP cofactor coordination

  • Decarboxylation reaction

  • Product release

The comparison of wild-type and mutant enzymes can provide detailed insights into the reaction mechanism.

Previous structural studies of S. enterica CobD revealed how the enzyme directs the breakdown of the external aldimine toward decarboxylation instead of amino transfer . This mechanistic insight resulted from analyzing multiple structural states of the enzyme. A similar approach with S. sanguinis CobD would illuminate any species-specific aspects of catalysis.

What are the most effective experimental designs for studying interactions between CobD and other cobalamin biosynthesis enzymes?

Studying protein-protein interactions in the cobalamin biosynthetic pathway requires specialized approaches to capture both stable and transient interactions. The following experimental design strategies are recommended:

In vitro Interaction Studies:

  • Pull-down assays: Using recombinant His-tagged CobD as bait to identify interaction partners from S. sanguinis lysates

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between CobD and potential partners

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of interactions

  • Analytical Ultracentrifugation: To characterize complex formation and stoichiometry

In vivo Interaction Studies:

  • Bacterial Two-Hybrid (B2H) system: Adapted for S. sanguinis to screen for interactions

  • Co-immunoprecipitation: Using antibodies against CobD to pull down interaction partners

  • Fluorescence Resonance Energy Transfer (FRET): For monitoring interactions in living cells

  • Cross-linking coupled with mass spectrometry: To capture transient interactions

Pathway Reconstitution:
Reconstitution of partial or complete cobalamin biosynthesis pathways in vitro using purified components can reveal functional interactions and potential metabolic channeling. This approach would be particularly valuable for understanding how CobD integrates into the broader biosynthetic machinery.

Based on cobalamin biosynthesis studies in other organisms, CobD likely interacts with:

Potential Interacting PartnerFunctionNature of Interaction
CbiBAttachment of aminopropanol to cobyric acidFunctional coupling
CbiPAmidation of side chainsSequential pathway steps
CobUPhosphorylation and GMP additionDownstream process
Metabolite channeling proteinsSubstrate transferTransient complex formation

Understanding these interactions is crucial for elucidating the complete cobalamin biosynthesis pathway in S. sanguinis and may reveal potential targets for antimicrobial development.

How do post-translational modifications affect S. sanguinis CobD activity and stability?

Post-translational modifications (PTMs) can significantly impact enzyme function, though specific information about PTMs in S. sanguinis CobD is limited in the available search results. A comprehensive research approach to address this question would include:

Identification of PTMs:

  • Mass Spectrometry Analysis: High-resolution LC-MS/MS of purified native S. sanguinis CobD to identify PTMs

  • Phosphoproteomic Analysis: To detect phosphorylation sites that might regulate activity

  • Targeted PTM Detection: Western blotting with PTM-specific antibodies

Functional Impact Assessment:

  • Site-directed mutagenesis: Mutation of modified residues to mimic or prevent modification

  • Enzyme Kinetics: Comparative analysis of activity parameters between modified and unmodified forms

  • Stability Assays: Thermal shift assays and limited proteolysis to assess structural stability changes

Regulatory Context:

  • Growth Condition Variation: Analysis of PTM patterns under different growth conditions

  • Pathway Integration: Assessment of how PTMs coordinate CobD activity with other cobalamin biosynthesis enzymes

Common PTMs that might affect CobD function include:

Potential PTMResidues AffectedPotential Functional Impact
PhosphorylationSer, Thr, TyrActivity regulation, protein-protein interactions
AcetylationLysAltering active site properties, protein stability
OxidationMet, CysRedox regulation, response to oxidative stress
PLP bindingLys in active siteEssential for catalytic activity

The PLP (pyridoxal 5'-phosphate) cofactor binding is particularly important for CobD function as it forms a Schiff base with a conserved lysine residue in the active site, which is crucial for the decarboxylation reaction mechanism . This represents a form of co-translational modification essential for catalytic activity.

Understanding PTMs in S. sanguinis CobD could provide insights into how this organism regulates cobalamin biosynthesis in response to environmental conditions and metabolic demands.

What are the implications of CobD function for developing novel antimicrobial strategies against S. sanguinis?

The exploration of CobD as a target for antimicrobial development presents an intriguing research direction. Several factors make this approach promising:

Research strategies for antimicrobial development targeting CobD include:

Target Validation Approaches:

  • Gene knockout studies to confirm essentiality in different growth conditions

  • Conditional expression systems to evaluate the effects of CobD depletion

  • Animal models to assess the impact on virulence and colonization

Inhibitor Discovery Strategies:

  • Structure-based design targeting the active site or allosteric sites

  • High-throughput screening of compound libraries against purified CobD

  • Fragment-based drug discovery to identify initial chemical scaffolds

Potential Inhibition Mechanisms:

  • Competitive inhibitors of L-threonine-O-3-phosphate binding

  • PLP cofactor analogs that inactivate the enzyme

  • Allosteric inhibitors that disrupt dimerization or conformational changes

To assess the broader impact of targeting cobalamin biosynthesis, evaluation of multiple pathway enzymes may be warranted, as previous studies have shown that strategies targeting individual sortase enzymes (which process cell wall-anchored proteins) showed only modest effects on S. sanguinis virulence .

How can comparative genomics inform our understanding of CobD evolution and specialization in S. sanguinis?

Comparative genomics offers powerful insights into the evolution and specialization of CobD in S. sanguinis within the broader context of bacterial cobalamin biosynthesis. This approach can address several key questions:

Evolutionary Conservation and Divergence:
Analysis of CobD sequences across bacterial species reveals that cobalamin biosynthesis follows at least two distinct routes—aerobic and anaerobic pathways . While these pathways share similarities, they are genetically distinct and employ different enzymes for certain steps .

The anaerobic pathway (found in organisms like Salmonella enterica) inserts cobalt early and uses oxygen-independent mechanisms for ring contraction, while the aerobic pathway (as in Pseudomonas denitrificans) inserts cobalt late and requires oxygen for ring contraction .

Phylogenetic Analysis Framework:

  • Sequence Alignment: Multiple sequence alignment of CobD homologs across diverse bacterial taxa

  • Phylogenetic Tree Construction: Using maximum likelihood or Bayesian methods

  • Synteny Analysis: Examining the genomic context of cobD genes across species

  • Structural Comparison: Mapping sequence conservation onto structural models

Specialization Indicators:
Examination of selection pressure on different regions of the CobD protein can reveal:

  • Highly conserved catalytic residues essential for function

  • Variable regions that may confer species-specific properties

  • Evidence of horizontal gene transfer events

A comprehensive analysis would include comparing CobD across oral streptococci and other important reference species:

Species GroupRepresentative TaxaCobD CharacteristicsPathway Type
Oral streptococciS. sanguinis, S. mutans, S. gordoniiSubject of investigationTo be determined
Enteric bacteriaSalmonella entericaWell-characterizedAnaerobic
Soil bacteriaPseudomonas denitrificansWell-characterizedAerobic
Other pathogensVarious speciesComparative referenceVarious

This comparative approach could reveal how S. sanguinis CobD has been shaped by its ecological niche and metabolic requirements, potentially identifying unique features that could be exploited for targeted antimicrobial strategies.

What advanced analytical techniques can optimize recombinant S. sanguinis CobD production for structural studies?

Optimizing recombinant S. sanguinis CobD production for structural studies requires sophisticated analytical techniques and production strategies. The following comprehensive approach is recommended:

Expression System Optimization:

  • Vector Engineering:

    • Promoter strength variation to balance expression level and solubility

    • Fusion partner screening (MBP, SUMO, thioredoxin) to enhance solubility

    • Inclusion of solubility-enhancing tags with precise protease cleavage sites

  • Host Strain Selection:

    • Comparative analysis of expression in various E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Consideration of Gram-positive expression hosts for proper folding

    • Screening for codon optimization requirements

Process Analytics:

  • Real-time Expression Monitoring:

    • Online fluorescence monitoring using GFP fusion constructs

    • Sampling for SDS-PAGE analysis at defined intervals

    • Correlation of optical density with protein expression levels

  • Solubility and Folding Assessment:

    • Differential scanning fluorimetry for thermal stability

    • Circular dichroism for secondary structure analysis

    • Limited proteolysis to identify stable domains

    • Size exclusion chromatography with multi-angle light scattering to assess oligomeric state

Purification Strategy Development:

TechniqueApplicationAnalytical Method for Optimization
IMACInitial captureDynamic binding capacity determination
Ion exchangeIntermediate purificationpH and conductivity scouting
Hydrophobic interactionContaminant removalAmmonium sulfate precipitation curves
Size exclusionFinal polishingMulti-detector analysis (UV, RI, MALS)

Activity Correlation:

  • Development of high-throughput activity assays to correlate structural integrity with function

  • Identification of stabilizing ligands or cofactors for co-crystallization

Crystallization Screening:

  • Dynamic light scattering to assess sample homogeneity

  • Thermal shift assays to identify stabilizing buffer conditions

  • Systematic crystallization condition screening using sparse matrix and custom designed arrays

For S. sanguinis CobD, special attention should be paid to ensuring the proper incorporation of the PLP cofactor, which is essential for the enzyme's function . Co-expression with chaperones may also be beneficial for obtaining properly folded protein suitable for structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.