Recombinant Streptococcus thermophilus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Streptococcus thermophilus Lipoprotein Signal Peptidase (LspA) is a genetically engineered enzyme responsible for cleaving signal peptides from bacterial lipoproteins. This post-translational modification is critical for lipoprotein maturation, enabling membrane anchoring and functional activation . In S. thermophilus, LspA facilitates the removal of N-terminal signal peptides containing a conserved "lipobox" motif (LxxC), ensuring proper localization of lipoproteins to the cell membrane . The recombinant form is produced in Escherichia coli with a His-tag for purification and research applications .

Gene and Enzyme Characteristics

  • Gene Name: lspA (synonyms: stu0521) .

  • UniProt ID: Q5M5G2 .

  • Catalytic Activity: Aspartic peptidase (EC 3.4.23.36) .

  • Conserved Domains:

    • Four transmembrane regions .

    • Catalytic dyad (Asp-14 and other conserved residues) critical for cleavage activity .

Mechanistic Insights

  • LspA belongs to a class of aspartic peptidases inhibited by pepstatin and globomycin, antibiotics that mimic the tetrahedral intermediate of the substrate .

  • Structural studies of homologs (e.g., Staphylococcus aureus LspA) reveal that globomycin and myxovirescin bind identically to the enzyme’s active site, blocking signal peptide cleavage .

Role in Bacterial Physiology

  • In S. thermophilus, LspA is essential for processing lipoproteins involved in nutrient uptake, cell envelope integrity, and virulence .

  • Mutants lacking functional LspA accumulate unprocessed lipoproteins, impairing membrane localization and bacterial fitness .

Applications in Biotechnology

  • Antibiotic Development: LspA is a validated target for novel antibiotics, particularly against methicillin-resistant S. aureus (MRSA) .

  • Industrial Use: Recombinant LspA enables high-throughput screening of inhibitors and structural studies for drug design .

  • Protein Engineering: Used to study lipoprotein processing in lactic acid bacteria, optimizing strains for dairy fermentations .

Handling and Stability

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Comparative Analysis

FeatureS. thermophilus LspAS. aureus LspA
Length153 aa 164 aa
InhibitorsGlobomycin, myxovirescin Globomycin
Structural MotifsAspartic peptidase catalytic dyad Identical binding pocket for antibiotics

Future Directions

  • Structural Studies: High-resolution crystallography to map substrate interactions.

  • Antimicrobial Synergy: Explore LspA inhibitors combined with cell wall-targeting drugs .

  • Strain Optimization: Engineer S. thermophilus with modified LspA to enhance fermentation efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; str0521; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Streptococcus thermophilus (strain CNRZ 1066)
Target Names
lspA
Target Protein Sequence
MRKVAIPVAILALIGLDQWVKHWVVANISLNQVIKAIPGVFSLTYLQNRGAAFSILQNQK YFFVILTVLVIGAALFYLVKNYQKSLWLVLSLILIISGGIGNFIDRVHLGYVVDMVQLDF IDFAIFNVADSYLTVGVLLLILILWKEENGSHH
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: stc:str0521

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.