Recombinant Streptomyces coelicolor ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Description

ATP Synthase Subunits in S. coelicolor

The ATP synthase complex in S. coelicolor consists of multiple subunits critical for ATP synthesis via oxidative phosphorylation. Key subunits characterized include:

GeneSubunitFunctionRecombinant ProductionSource
atpAαCatalytic core; binds ADP/ATPExpressed in E. coli as His-tagged protein (partial sequence: 1-184aa)
atpDβCatalytic site for ATP synthesisOverexpression enhances homologous recombination repair (HDR) during genome editing
atpEcMembrane-embedded proton channelFull-length recombinant protein produced in E. coli (1-76aa, His-tagged)
atpFbStator structure linking F₀ and F₁ domainsFull-length recombinant protein expressed in E. coli (1-184aa, His-tagged)

These subunits are integral to the F₁F₀-ATP synthase, which couples proton translocation across the membrane to ATP synthesis. Notably, overexpression of atpD (β-subunit) increases HDR efficiency by 10%, enabling improved CRISPR-Cas9 genome editing in Streptomyces .

Recombinant Protein Production in Streptomyces

Streptomyces species are widely used for recombinant protein production due to their efficient secretion systems and post-translational modification capabilities. For example:

  • Secretion Efficiency: 77 out of 94 recombinant proteins produced in Streptomyces were fully secreted, with yields up to 100s of mg/L .

  • Common Signal Peptides: Signal sequences from S. venezuelae subtilisin inhibitor ( vsi) and S. tendae α-amylase are frequently used to direct extracellular secretion .

Regulatory and Metabolic Context

ATP synthase activity is tightly linked to metabolic pathways in S. coelicolor:

  • Glycogen Synthesis: ADP-glucose pyrophosphorylase (ADP-Glc PPase), regulated by metabolites like mannose-6-phosphate and NADPH, directs glucose-1-phosphate toward glycogen synthesis rather than antibiotic production .

  • Stress Responses: σᴱ, an extracytoplasmic sigma factor, represses genes like accA2 and accB (involved in actinorhodin biosynthesis) under non-stressed conditions, indirectly influencing energy metabolism .

Gaps in Knowledge on atpI

The term "ATP synthase protein I (atpI)" does not align with standard subunit nomenclature for S. coelicolor ATP synthase. Potential explanations include:

  • Nomenclature Variability: atpI may refer to an uncharacterized or accessory subunit not yet documented in literature.

  • Typographical Error: The query might intend to reference well-characterized subunits (e.g., atpA, atpD).

Future Directions

Further studies could:

  1. Clarify the existence and role of atpI through genomic annotation or knockout studies.

  2. Optimize recombinant production of ATP synthase subunits for structural and functional analyses.

  3. Explore links between ATP synthase activity and secondary metabolite synthesis in Streptomyces.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; SCO5366; 2SC6G5.10; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
atpI
Target Protein Sequence
MPSNDVRILLQAAVPAAAVGAVAAVVSAVVAGGKGAVGAVVATVLAMLFMGIGLYVLQRT AKSLPHLFQAMGLMLYAAQILLLFVFLAAFKNTTLFNPRSFAVSLLVVTLAWIAAQTRAH MKAKVLYVEPEPTGEKPEKTGHSS
Uniprot No.

Target Background

Function
A possible function for this protein is to guide the assembly of the membrane sector of the ATPase enzyme complex.
Database Links

KEGG: sco:SCO5366

STRING: 100226.SCO5366

Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase protein I (atpI) in Streptomyces coelicolor physiology?

ATP synthase protein I (atpI) is a component of the ATP synthase complex in S. coelicolor that contributes to energy metabolism through oxidative phosphorylation. While the specific function of atpI has not been directly characterized in the provided research, studies have demonstrated that ATP metabolism significantly influences both antibiotic production and morphological differentiation in S. coelicolor . Extracellular ATP (exATP) acts as an effector for S. coelicolor physiology, with different concentrations producing opposite effects on antibiotic production . The ATP synthase complex, which includes the atpI subunit, is crucial for maintaining appropriate intracellular ATP levels that regulate these physiological processes.

Methodological approach: To study atpI function, researchers should consider both gene expression analysis during different growth phases and targeted genetic manipulation (knockout or overexpression) followed by phenotypic characterization, particularly focusing on changes in antibiotic production and morphological development.

How does ATP metabolism influence antibiotic production in S. coelicolor?

Research has established a clear relationship between ATP levels and antibiotic production in S. coelicolor. Experimental data shows that addition of 10 μM extracellular ATP enhances actinorhodin and undecylprodigiosin production, while higher concentrations (100 μM) reduce these effects . This regulation occurs at the transcriptional level, as evidenced by enhanced promoter activity of actII-orf4 (a pathway-specific regulator for actinorhodin biosynthesis) in response to optimal exATP concentrations . As the primary source of cellular ATP, the ATP synthase complex likely plays a crucial role in establishing the ATP levels that influence these secondary metabolic pathways.

exATP ConcentrationEffect on ActinorhodinEffect on UndecylprodigiosinEffect on Morphological Differentiation
10 μMEnhancedEnhancedEnhanced
100 μMReducedReducedReduced

Table 1: Effects of different extracellular ATP concentrations on antibiotic production and differentiation in S. coelicolor

What expression patterns do ATP synthase genes show during S. coelicolor growth phases?

ATP synthase gene expression in S. coelicolor varies throughout growth phases, correlating with changing energy demands. While the search results don't specifically analyze ATP synthase genes, comparative transcriptome and proteome analysis methodologies have been successfully applied to study growth phase-related expression patterns in S. coelicolor . Research has employed temporally spaced sampling (7h to 38h) that captures the transition from exponential growth to stationary phase and the onset of antibiotic production . This methodological framework can be applied to analyze ATP synthase expression patterns in relation to physiological changes.

Methodological approach: Use iTRAQ-based proteomic analysis of samples collected at multiple time points throughout growth, with experimental designs that distribute protein samples across multiple mass spectrometric analysis runs and include overlapping samples to enable validation .

How can recombinant atpI be effectively expressed and purified for structural and functional studies?

Expressing recombinant atpI from S. coelicolor requires careful consideration of vector design, transformation methods, and host selection:

  • Vector selection: Bifunctional vectors containing both Streptomyces and E. coli replicons (e.g., from pBR322, pBR324, pBR325) allow for genetic manipulation in E. coli before transformation into Streptomyces .

  • Transformation method: Single-stranded DNA-mediated gene transfer systems can bypass host cell restriction systems, enabling efficient transformation even into highly restrictive Streptomyces strains .

  • Selectable markers: Various antibiotic resistance genes can be used, including apramycin, kanamycin, and thiostrepton, with apramycin resistance being particularly useful as it works in both E. coli and Streptomyces .

  • Host strain selection: Both restricting and non-restricting strains of Streptomyces can serve as expression hosts, with selection depending on research goals .

Vector ComponentOptionsFeatures
E. coli repliconpBR322, pBR324, pBR325Allow manipulation in E. coli
Streptomyces repliconSCP2*, pIJ702Enable replication in Streptomyces
Selectable markersApramycin, kanamycin, thiostrepton, neomycinEnable selection of transformants

Table 2: Key components for vectors used in recombinant protein expression in Streptomyces

What is the relationship between ATP levels, chromosomal topology, and gene expression in S. coelicolor?

Research indicates a complex interrelationship between energy metabolism, chromosomal topology, and gene expression in S. coelicolor. During the Streptomyces developmental cycle, multiple copies of GC-rich linear chromosomes undergo profound topological changes, from loosely condensed in vegetative hyphae to highly compacted in spores . Changes in chromosomal supercoiling have been associated with the control of antibiotic production and environmental stress response .

A study on topoisomerase I (TopA) identified genes involved in the transcriptional response to long-term supercoiling imbalance, with affected genes preferentially organized in several clusters, including a supercoiling-hypersensitive cluster located in the core of the S. coelicolor chromosome . This suggests that energy metabolism genes, potentially including ATP synthase components, may be regulated in part through changes in DNA topology that occur during development and in response to environmental conditions.

Methodological approach: Use strains with controlled expression of topoisomerase genes to study the effects of altered chromosomal topology on ATP synthase gene expression and function.

How do transcriptomic and proteomic approaches reveal the regulatory networks integrating ATP metabolism with antibiotic production?

Integrated transcriptomic and proteomic approaches have revealed complex regulatory networks in S. coelicolor. For example, research on the small ORF trpM demonstrated that its overexpression causes an over-representation of factors involved in protein synthesis and nucleotide metabolism, along with down-representation of proteins involved in central carbon and amino acid metabolism . This corresponds to differential accumulation patterns of amino acids and central carbon intermediates, ultimately affecting antibiotic production .

The iTRAQ system has been successfully employed for proteomic analysis of temporally spaced samples throughout growth phases . When combined with transcriptomic data, this approach can identify post-transcriptional regulation mechanisms that might affect ATP synthase expression and activity.

Methodological approach: Design experiments that integrate multiple omics approaches (transcriptomics, proteomics, metabolomics) across growth phases, and use computational methods to identify regulatory networks connecting ATP metabolism with secondary metabolite production.

What experimental designs are optimal for studying the effects of ATP on antibiotic production in S. coelicolor?

Optimal experimental designs for studying the effects of ATP on antibiotic production should include:

  • Concentration gradient: Test various concentrations of extracellular ATP, with particular attention to the range around 10 μM, which enhances antibiotic production, and 100 μM, which reduces it .

  • Time-course analysis: Monitor antibiotic production (actinorhodin and undecylprodigiosin) over time following ATP addition, correlating with growth phases and morphological development .

  • Promoter activity analysis: Measure the activity of key regulatory promoters (e.g., actII-orf4) to understand transcriptional effects using reporter gene fusions .

  • Intracellular ATP measurement: Monitor changes in intracellular ATP concentrations in response to extracellular ATP addition to understand feedback mechanisms .

  • Growth medium comparison: Test effects on both solid and liquid media, as morphological development and antibiotic production patterns differ between these conditions .

Experimental ParameterRecommendationRationale
exATP concentration range1-100 μM with fine gradations around 10 μM10 μM enhances while 100 μM reduces antibiotic production
Sampling timepointsMultiple points across growth phasesCaptures dynamic responses to ATP addition
Reporter constructsactII-orf4 promoter fusionsMonitors transcriptional regulation of antibiotic biosynthesis
Growth conditionsBoth solid and liquid mediaEffects may differ between growth conditions

Table 3: Recommended experimental parameters for studying ATP effects on S. coelicolor physiology

How can genetic manipulation techniques be optimized for studying atpI function in S. coelicolor?

Genetic manipulation of atpI in S. coelicolor can be optimized through:

  • Inducible expression systems: Use of promoters with titratable expression levels allows for fine control of atpI expression. This approach can overcome potential lethality issues associated with complete knockout of essential ATP synthase components.

  • Vector design: Bifunctional vectors containing both E. coli and Streptomyces replicons facilitate genetic manipulation . Vectors carrying apramycin resistance are particularly useful as selectable markers that function in both organisms .

  • Transformation method: Single-stranded DNA-mediated gene transfer systems can bypass host cell restriction systems, enabling efficient transformation even into highly restrictive Streptomyces strains .

  • Site-directed mutagenesis: Introduction of specific mutations can help identify functional residues without completely eliminating protein function.

Methodological approach: For essential genes like those encoding ATP synthase components, consider using conditional expression systems or targeted mutagenesis rather than complete knockouts.

What analytical techniques provide the most comprehensive data on ATP synthase function and regulation?

A comprehensive analysis of ATP synthase function and regulation requires multiple complementary techniques:

  • Enzymatic activity assays: Measure ATP synthase activity in membrane preparations under various conditions to assess functional consequences of genetic modifications or environmental perturbations.

  • Proteomic analysis: Use iTRAQ-based approaches to quantify changes in ATP synthase subunit abundance across growth phases or in response to environmental conditions .

  • Transcriptomic analysis: RNA-seq or microarray analysis can reveal transcriptional regulation of ATP synthase genes in coordination with other cellular processes.

  • Metabolomic profiling: Quantify ATP, ADP, and other energy-related metabolites to correlate with enzyme activity and expression levels.

  • Protein-protein interaction studies: Identify interaction partners of ATP synthase components to understand regulatory mechanisms.

Methodological approach: Design experiments that integrate these techniques to build a comprehensive model of ATP synthase function and regulation in the context of S. coelicolor development and secondary metabolism.

How can genome mining approaches identify and analyze ATP synthase-related genes across Streptomyces species?

Genome mining approaches for ATP synthase-related genes can leverage the extensive genomic data available for Streptomyces species. While the search results focus primarily on biosynthetic gene clusters, the methodological approaches are applicable to ATP synthase genes:

  • Comparative genomics: Analysis of multiple Streptomyces genomes reveals gene diversity and distribution patterns, even among closely related strains . For ATP synthase components, this approach can identify species- or strain-specific variations that might correlate with differences in energy metabolism or antibiotic production.

  • Phylogenetic analysis: Constructing phylogenetic trees of ATP synthase components across Streptomyces species can reveal evolutionary relationships and potentially functional adaptations.

  • Promoter analysis: Identifying conserved regulatory elements in the promoter regions of ATP synthase genes can provide insights into their regulation.

  • Strain-level analysis: Genome sequencing of multiple strains of the same species can uncover strain-specific variations in ATP synthase genes that might contribute to phenotypic differences .

Methodological approach: Combine bioinformatic analysis with functional validation to establish relationships between sequence variations and phenotypic differences in energy metabolism or secondary metabolite production.

How do you resolve contradictory data on ATP synthase expression and function across different studies?

Resolving contradictions in ATP synthase data requires careful consideration of methodological differences and experimental conditions:

  • Growth conditions: Different media compositions, growth phases, and environmental stressors can significantly affect gene expression and protein function in S. coelicolor . Standardizing growth conditions or explicitly accounting for these variables is essential.

  • Strain variations: Even strains considered to be the same species can vary tremendously in their genetic content and expression patterns . Genome sequencing of experimental strains can identify relevant genetic differences.

  • Methodological differences: Different techniques for measuring gene expression or protein activity may yield different results due to varying sensitivities and biases. Complementary approaches should be used for validation.

  • Data integration: Combining transcriptomic and proteomic data can help resolve discrepancies by distinguishing between transcriptional and post-transcriptional effects .

Methodological approach: When comparing across studies, account for differences in strain background, growth conditions, and analytical methods. When designing new studies, include appropriate controls and use multiple complementary techniques to validate key findings.

What statistical approaches are most appropriate for analyzing multivariate data on ATP synthase in relation to antibiotic production?

Analysis of complex relationships between ATP synthase function, energy metabolism, and antibiotic production requires sophisticated statistical approaches:

  • Correlation analysis: Pearson or Spearman correlation can identify relationships between ATP levels, ATP synthase expression, and antibiotic production across conditions.

  • Principal Component Analysis (PCA): This technique can reduce dimensionality in multivariate datasets, helping to identify patterns and relationships among variables.

  • Partial Least Squares (PLS) regression: This method is particularly useful for relating multiple dependent variables (e.g., antibiotic production) to multiple independent variables (e.g., expression levels of various ATP synthase components).

  • Time-series analysis: Specialized statistical methods for time-series data can capture dynamic relationships between ATP metabolism and antibiotic production throughout growth phases.

  • Network analysis: Integration of multiple data types (genomic, transcriptomic, proteomic, metabolomic) using network-based approaches can reveal regulatory connections between energy metabolism and secondary metabolism.

Methodological approach: Choose statistical methods appropriate for the specific experimental design and data structure, and validate findings using independent datasets or complementary analytical approaches.

How might synthetic biology approaches enhance our understanding of atpI function in S. coelicolor?

Synthetic biology offers powerful approaches for studying atpI function:

  • Designer ATP synthase complexes: Using synthetic biology to create modified ATP synthase complexes with altered subunit compositions or properties could provide insights into the specific contributions of atpI.

  • Orthogonal expression systems: Developing inducible and tunable expression systems for atpI and other ATP synthase components would enable precise control of their expression levels and timing.

  • Biosensor development: Creating ATP-responsive biosensors could allow real-time monitoring of ATP levels in living cells, facilitating studies on the relationship between ATP dynamics and physiological processes.

  • Minimal synthetic systems: Reconstituting minimal ATP synthase complexes in heterologous hosts could help define the essential components and their interactions.

Methodological approach: Design modular genetic constructs that allow systematic variation of ATP synthase components, combined with high-throughput phenotypic analysis to identify functional relationships.

What emerging technologies could advance research on ATP synthase structure and function in Streptomyces?

Several emerging technologies hold promise for advancing ATP synthase research:

Methodological approach: Combine these advanced technologies with traditional biochemical and genetic approaches to build comprehensive models of ATP synthase function in the context of Streptomyces physiology.

How might understanding atpI function contribute to enhancing antibiotic production in industrial strains?

Understanding atpI function could contribute to antibiotic production enhancement through:

  • Metabolic engineering: Targeted modifications of ATP synthase or related energy metabolism components could optimize energy allocation for antibiotic production .

  • Process optimization: Knowledge of how ATP levels affect antibiotic production could inform bioreactor design and operation, including strategic addition of extracellular ATP at optimal concentrations and times .

  • Strain development: Selection or engineering of strains with optimized ATP synthase function could enhance antibiotic yields.

  • Regulatory circuit design: Engineering artificial regulatory circuits linking ATP levels to antibiotic biosynthesis gene expression could enhance production.

Methodological approach: Design experiments that systematically investigate the relationship between ATP synthase function, energy metabolism, and antibiotic production under industrially relevant conditions, focusing on identifying manipulable parameters that enhance production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.