Recombinant Streptomyces coelicolor ATP synthase subunit b (atpF)

What is the ATP synthase subunit b (atpF) in Streptomyces coelicolor?

ATP synthase subunit b (atpF) is a component of the F-type ATPase complex in Streptomyces coelicolor. The full-length protein consists of 184 amino acids and functions as part of the F0 sector of ATP synthase. The amino acid sequence is: MSPMLQIAAEEMENPLIPPIPELVIGLIAFVIVFGFLAKKLLPNINKVLEERREAIEGGI EKAEAAQTEAQSVLEQYKAQLAEARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIIAA GHAQIQADRKAAASALRQDVGKLATELAGKLVGESLEDHARQSRVIDRFLDELDDKATTA EATR . This protein plays a crucial role in the ATP synthesis machinery, contributing to energy production in this bacterial species.

How is the atpF gene organized in the Streptomyces coelicolor genome?

In S. coelicolor, the atpF gene is identified as SCO5369 (2SC6G5.13) in the genome . It is part of a larger operon containing all subunits of the F0F1-ATP synthase complex along with a regulatory protein I . This operon structure is significant for coordinated expression of all components required for a functional ATP synthase complex. The gene location and organization provide insights into the regulatory mechanisms controlling energy metabolism in Streptomyces species.

What is the relationship between atpF and other ATP synthase subunits in Streptomyces?

The atpF-encoded b subunit works in concert with other subunits (α, β, γ, δ, ε, a, and c) to form the complete F0F1-ATP synthase complex . Specifically, the b subunit is part of the membrane-embedded F0 sector that forms the proton channel. Research has shown that the β-subunit (AtpD) is particularly important in Streptomyces metabolism and has been identified as a target for phosphorylation, suggesting post-translational regulation of ATP synthase activity . The coordination between these subunits is essential for proper ATP synthesis and energy homeostasis in Streptomyces.

What post-translational modifications occur on ATP synthase subunit b in Streptomyces?

Phosphorylation is a key post-translational modification identified on ATP synthase subunit b in Streptomyces. Two-dimensional gel electrophoresis and mass spectrometry analyses have revealed that both β- and b-subunits of the F0F1-ATP synthase complex undergo phosphorylation in Streptomyces fradiae ATCC 19609 . This phosphorylation occurs via serine/threonine protein kinases (STPKs). Recent phosphoproteomic studies using zirconium (IV) affinity chromatography have expanded our understanding of phosphorylation patterns in Streptomyces, showing differential phosphorylation during vegetative and sporulating stages . These modifications are believed to regulate ATP synthase activity in response to changing metabolic demands.

How does ATP synthase regulation affect secondary metabolism in Streptomyces coelicolor?

ATP synthase regulation is intricately connected to secondary metabolism in S. coelicolor. Overexpression of AtpD (β-subunit) has been shown to enhance homologous DNA recombination, which can be leveraged for genetic engineering approaches . Additionally, extracellular ATP (exATP) at concentrations of 10 μM has been demonstrated to enhance actinorhodin and undecylprodigiosin production, alongside promoting morphological differentiation on solid medium . The enhanced promoter activity of actII-ORF4 (a key regulator of actinorhodin biosynthesis) under exATP conditions indicates that ATP-related signaling affects transcriptional regulation of antibiotic production. These findings establish a link between energy metabolism and secondary metabolite biosynthesis in Streptomyces.

What is the significance of protein phosphorylation in regulating ATP synthase activity in Streptomyces?

Protein phosphorylation serves as a rapid and reversible mechanism for modulating ATP synthase activity in response to changing metabolic needs. Research has demonstrated that the phosphorylation of ATP synthase subunits (including subunit b) likely participates in regulating various steps of ATP synthase assembly and function . In S. coelicolor, phosphorylation patterns differ between vegetative and antibiotic-producing sporulating stages, suggesting stage-specific regulation . The involvement of serine/threonine protein kinases in this process presents potential targets for manipulating ATP production and, consequently, secondary metabolism. Understanding these phosphorylation patterns is crucial for developing strategies to enhance antibiotic production in Streptomyces species.

What are the optimal expression systems for producing recombinant Streptomyces coelicolor ATP synthase subunit b?

E. coli expression systems have been successfully used to produce recombinant S. coelicolor ATP synthase subunit b (atpF). The protein can be expressed with an N-terminal His-tag to facilitate purification . The optimal approach involves:

• Codon optimization for E. coli expression

• Use of pET-based expression vectors

• Induction with IPTG under controlled temperature (typically 25-30°C to reduce inclusion body formation)

• Expression in BL21(DE3) or similar strains

The resulting protein can be purified using nickel affinity chromatography and stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For functional studies, reconstitution in a lipid environment may be necessary to maintain the native conformation of this membrane protein.

How can researchers effectively isolate and purify native ATP synthase complexes from Streptomyces coelicolor?

Isolation of native ATP synthase complexes from S. coelicolor requires a multi-step approach:

• Membrane vesicle preparation: Create inverted membrane vesicles by cell disruption (sonication or French press) followed by differential centrifugation.

• Detergent solubilization: Solubilize membrane proteins using mild detergents (DDM or Triton X-100).

• Chromatographic separation:

  • Ion exchange chromatography

  • Size exclusion chromatography

  • Affinity chromatography if using tagged proteins

For phosphoproteomic analysis, researchers should incorporate phosphatase inhibitors (sodium fluoride, sodium orthovanadate) throughout the purification process to preserve phosphorylation states . Two-dimensional gel electrophoresis followed by mass spectrometry has been successfully applied to identify phosphorylated subunits of the ATP synthase complex . This approach allows for the isolation of functionally active complexes suitable for biochemical and structural studies.

What techniques are most effective for studying atpF phosphorylation in Streptomyces?

To study atpF phosphorylation in Streptomyces, researchers should consider these methodological approaches:

• Enrichment strategies: Zirconium (IV) affinity chromatography has proven more effective than traditional TiO2 enrichment, identifying 154 novel phosphoproteins not detected by previous methods .

• Mass spectrometry analysis: LC-MS/MS following phosphopeptide enrichment allows identification of specific phosphorylation sites.

• Quantitative proteomics: iTRAQ (isobaric tags for relative and absolute quantitation) labeling enables comparison of phosphorylation levels across different developmental stages .

• In vitro phosphorylation assays: Using purified serine/threonine protein kinases and recombinant ATP synthase subunits to validate kinase-substrate relationships .

• Phosphomimetic mutations: Creating mutations at identified phosphorylation sites (S→D or T→E) to mimic phosphorylation, or phosphoablative mutations (S→A or T→A) to prevent phosphorylation, followed by functional assays.

These techniques provide complementary information about the phosphorylation status of atpF and its functional implications.

How does ATP synthase subunit b contribute to genome editing efficiency in Streptomyces?

The ATP synthase β-subunit (AtpD) overexpression has been shown to significantly improve genome editing efficiency in Streptomyces using CRISPR/Cas9 systems. Researchers have demonstrated that:

• The expression of AtpD under a strong constitutive promoter (ermEp*) in conjunction with controlled Cas9 expression resulted in approximately 10% genome editing efficiency under non-induction conditions .

• This approach increased transformation efficiency by about 250-fold and enhanced the probability of obtaining mutants by nearly 30-fold compared to traditional CRISPR/Cas9 systems .

• When combined with triple controls of Cas9 activity (at transcriptional, translational, and protein levels) and subsequent induction, up to 80% deletion efficiency was observed at specific loci like actII-ORF4 .

The mechanism involves enhanced homology-directed repair (HDR) after Cas9-induced double-strand breaks, likely due to increased ATP availability for the energy-dependent HDR process . This demonstrates the critical role of energy metabolism in genetic manipulation techniques.

What is the relationship between ATP synthase activity and antibiotic production in Streptomyces coelicolor?

The relationship between ATP synthase activity and antibiotic production in S. coelicolor is complex and bidirectional:

• Energy supply for biosynthesis: ATP synthase provides the energy required for antibiotic biosynthesis pathways. Quantitative proteomics analyses reveal a metabolic switch from primary to secondary metabolism during S. coelicolor development .

• Regulatory connections:

  • Extracellular ATP at 10 μM concentrations enhances actinorhodin and undecylprodigiosin production, whereas higher concentrations (100 μM) reduce these phenotypes .

  • The enhanced promoter activity of actII-ORF4 (a pathway-specific regulator of actinorhodin biosynthesis) in response to exATP indicates transcriptional regulation .

• Differential phosphorylation: Specialized metabolism regulators including AfsR (a global regulator of antibiotic production) show differential phosphorylation between vegetative and antibiotic-producing stages .

These findings suggest that modulating ATP synthase activity could be a strategy for enhancing antibiotic production in industrial strains.

How can researchers leverage ATP synthase manipulations for enhancing secondary metabolite production?

Researchers can employ several strategies to manipulate ATP synthase activity for enhanced secondary metabolite production:

• Controlled extracellular ATP addition: Adding 10 μM exATP to S. coelicolor cultures can enhance actinorhodin and undecylprodigiosin production . A data table from experimental results shows:

  exATP Concentration	Actinorhodin Production	Undecylprodigiosin Production	Morphological Differentiation
  0 μM (control)	Baseline	Baseline	Normal
  10 μM	Enhanced	Enhanced	Enhanced
  100 μM	Reduced	Reduced	Reduced

• AtpD overexpression: Expressing the ATP synthase β-subunit under strong constitutive promoters can enhance energy availability for secondary metabolism .

• Targeted phosphorylation engineering: Using the knowledge of ATP synthase phosphorylation patterns to create phosphomimetic mutations at key regulatory sites .

• Integration with genetic engineering approaches: Combining ATP synthase manipulations with CRISPR/Cas9-based pathway engineering for activating cryptic biosynthetic gene clusters .

These approaches represent promising strategies for activating or enhancing the production of valuable secondary metabolites in Streptomyces species.

How conserved is the ATP synthase subunit b structure across different Streptomyces species?

ATP synthase subunit b structure shows significant conservation across Streptomyces species, reflecting its essential function in energy metabolism. Phylogenetic analyses indicate that F0F1-ATP synthase from Streptomyces fradiae ATCC 19609 shares similarity with respective proteins in both saprophytic and pathogenic bacteria, including Mycobacterium tuberculosis . This conservation extends to structural domains important for subunit interactions and function.

The membrane-spanning regions show particularly high conservation, while cytoplasmic domains may exhibit more variability. This pattern of conservation underscores the fundamental role of ATP synthase in bacterial physiology and suggests that insights gained from studying S. coelicolor atpF are likely applicable to other Streptomyces species and potentially to more distantly related actinomycetes.

What unique features distinguish Streptomyces ATP synthase from those in other bacterial genera?

Streptomyces ATP synthase exhibits several distinctive features compared to those in other bacterial genera:

• Phosphorylation patterns: S. coelicolor ATP synthase subunits (including subunit b) undergo extensive phosphorylation, with 41% pSer, 56.2% pThr, and 2.8% pTyr modifications identified . This level of post-translational modification appears more extensive than in many other bacteria.

• Regulation in developmental context: The activity and regulation of ATP synthase in Streptomyces are intricately linked to the complex developmental cycle, which involves distinct vegetative and reproductive mycelial stages . This developmental regulation is not observed in non-filamentous bacteria.

• Oligomycin sensitivity: Analysis of amino acid sequences in the c-subunit domains shows differences between oligomycin-sensitive and resistant organisms, with Streptomyces showing specific residues involved in oligomycin binding .

• Serine/threonine kinase regulation: The regulation of ATP synthase by serine/threonine protein kinases appears more prominent in Streptomyces and related actinomycetes compared to other bacterial genera .

These distinctive features likely reflect adaptations to the complex lifecycle and secondary metabolite production capabilities of Streptomyces species.

How does atpF expression change during different developmental stages in Streptomyces coelicolor?

Expression of atpF and other ATP synthase components varies significantly across the developmental stages of S. coelicolor:

• Vegetative mycelium stage: During the early compartmentalized vegetative mycelium (first mycelium) stage, ATP synthase components show high expression levels to support primary metabolism and rapid growth . Phosphoproteomic analysis reveals distinctive phosphorylation patterns during this stage, with 27 novel ribosomal proteins phosphorylated .

• Transition phase: As S. coelicolor transitions from primary to secondary metabolism, quantitative proteomics shows changes in ATP synthase expression coinciding with the activation of secondary metabolite pathways . This transition represents a major metabolic shift in the organism.

• Reproductive mycelium stage: In the multinucleated reproductive mycelium (second mycelium), ATP synthase expression patterns adjust to support secondary metabolism and sporulation . Differential phosphorylation of ATP synthase subunits during this stage suggests post-translational regulation of activity.

These stage-specific expression and modification patterns highlight the dynamic regulation of energy metabolism throughout Streptomyces development and its coordination with secondary metabolite production.